DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and AT4G20760

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001329369.1 Gene:AT4G20760 / 827824 AraportID:AT4G20760 Length:318 Species:Arabidopsis thaliana


Alignment Length:265 Identity:82/265 - (30%)
Similarity:132/265 - (49%) Gaps:35/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKELEDLAKNHSNIHILEIDLRNFDAYDK 69
            ::.|.:||:||..|:.||. .....::..||||.::|..|.||....|.    .:.::..|..|:
plant    67 MVQGASRGIGLEFVRQLLE-NNKNGYVVATCRNPKEATSLSDLKNRFSE----RLFIQKLDVTDE 126

  Fly    70 LVAD--IEGVTKDQG-LNVLFNNAGI-------APKSARITAVRSQELLDTLQTNTVVPIMLAKA 124
            ...:  .|.|.:..| ||:|.|.|||       .|::. :..|....|:...:.|.|.||::.|.
plant   127 TTIEESAESVREKYGSLNLLINAAGILSIPGVLQPETT-LNKVEKSSLMLAYEVNAVGPILVMKH 190

  Fly   125 CLPLLKKAAKANESQPMGVGRAAIINMSSILGSIQGNTDGGMYAYRTSKSALNAATKSLSVDLYP 189
            ..||||....:...:.:    |.:.|:|:.:|||..|..||.::||.||||||..||::||:|..
plant   191 MWPLLKAGGGSGTDREV----AVVANLSARVGSIGDNRLGGWHSYRASKSALNQLTKNVSVELGR 251

  Fly   190 QR--IMCVSLHPGWVKTDMGGSSAPL--DVPT--------STGQIVQTISKLGEKQNGGFVNYDG 242
            ::  :.|:.||||.|.||:   |.|.  :||.        |..:::..|:...::.:|.|..:||
plant   252 RKDPVACILLHPGTVDTDL---SRPFQRNVPDGKLFTREYSVQKLLHIINNTKKQDSGKFFAWDG 313

  Fly   243 TPLAW 247
            ..:.|
plant   314 QEIPW 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 81/263 (31%)
adh_short 4..209 CDD:278532 71/215 (33%)
AT4G20760NP_001329369.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 98 1.000 Domainoid score I2416
eggNOG 1 0.900 - - E2759_KOG1611
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2142
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D1390068at2759
OrthoFinder 1 1.000 - - FOG0000614
OrthoInspector 1 1.000 - - oto3005
orthoMCL 1 0.900 - - OOG6_100338
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.740

Return to query results.
Submit another query.