DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and zgc:65997

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_956847.1 Gene:zgc:65997 / 794398 ZFINID:ZDB-GENE-040426-1502 Length:262 Species:Danio rerio


Alignment Length:260 Identity:91/260 - (35%)
Similarity:141/260 - (54%) Gaps:27/260 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKELEDLAKNHSN-IHILEIDLRNFDAYD 68
            |:.|.:|||||...:.|| |.:.|..:..||||.:.|.||..|:..|:: :.:|.:|: |.:...
Zfish     6 LVQGSSRGLGLEFCRYLL-LNKSPAAIIATCRNPDAAHELSALSAQHADRLTVLRLDV-NREEDI 68

  Fly    69 KLVADIEGVTKDQG-LNVLFNNAGIAPKSAR----ITAVRSQELLDTLQTNTVVPIMLAKACLPL 128
            |..|  |.|....| ::::.|::.:...|.:    :..|.:|.::.||.||||.|:::||...||
Zfish    69 KTAA--ESVKTAFGKVDLIINSSAMLHPSGKGETSLRDVSAQGVISTLTTNTVGPLVMAKYFAPL 131

  Fly   129 LKKAAKANESQPMGVGR---AAIINMSSILGSIQGNTDGGMYAYRTSKSALNAATKSLSVDLYPQ 190
            |::...|...||....:   ..::||::.:|||..|..||.|:||.||:|||.||::||::|...
Zfish   132 LQRGTGAFGLQPPEKDKQHNGIMVNMTARVGSIGDNALGGWYSYRMSKAALNMATRNLSIELGRG 196

  Fly   191 R--IMCVSLHPGWVKTDMGGSSAPL------DVPTSTGQIVQTISKLGEKQNGGFVNYDGTPLAW 247
            |  |:|||||||.|.||:   |.|.      |...||...||.:..:.:..|   ::..|...||
Zfish   197 RSKIVCVSLHPGTVNTDL---SRPYHRNVQKDKLFSTEYSVQCLMNIIDNLN---IDKTGKAYAW 255

  Fly   248  247
            Zfish   256  255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 89/258 (34%)
adh_short 4..209 CDD:278532 80/214 (37%)
zgc:65997NP_956847.1 adh_short 4..217 CDD:278532 81/217 (37%)
carb_red_sniffer_like_SDR_c 5..262 CDD:187586 91/260 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1611
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D1390068at2759
OrthoFinder 1 1.000 - - FOG0000614
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100338
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.690

Return to query results.
Submit another query.