DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and zgc:158868

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001074098.1 Gene:zgc:158868 / 791147 ZFINID:ZDB-GENE-070112-892 Length:258 Species:Danio rerio


Alignment Length:254 Identity:96/254 - (37%)
Similarity:149/254 - (58%) Gaps:10/254 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NSILITGCNRGLGLGLVKALLNLPQPPQHLFTTCRN--REQAKELEDLAKNHSN-IHILEIDLRN 63
            :|:|:||.|||:||.||..|::||:.|.|:|..||:  ..:|:||.|||:.|.. |.::::|..:
Zfish     7 DSVLVTGSNRGIGLELVHQLVDLPKSPGHIFAGCRDPGGPKAQELRDLAQKHQGVITVVQLDTDS 71

  Fly    64 FDAYDKLVADIEGVTKDQGLNVLFNNAGI-APKSARITAVRSQELLDTLQTNTVVPIMLAKACLP 127
            .|:..:....:|.....:|||::.||||: .|.|  :.....:|::|:..||.|.|:::||...|
Zfish    72 PDSIKEASNLVESKLNGKGLNLIINNAGVNIPGS--LVETGKKEMVDSYTTNVVGPMLIAKNFHP 134

  Fly   128 LLKKAAKANESQPMGVGRAAIINMSSILGSI----QGNTDGGMYAYRTSKSALNAATKSLSVDLY 188
            ||.|||.......|...|.||:|:|::|.||    :......||.||..|:|||..|:.|:.|..
Zfish   135 LLCKAAAQFPQSSMSCSRPAIVNVSTLLSSITRCPENFYRSPMYPYRICKAALNMLTRCLAEDFR 199

  Fly   189 PQRIMCVSLHPGWVKTDMGGSSAPLDVPTSTGQIVQTISKLGEKQNGGFVNYDGTPLAW 247
            ...|:..|||||||:|:|||..|||....|...:::.|:.|.||.:|..::::|..:.|
Zfish   200 KDGILVASLHPGWVRTEMGGPQAPLTTAESVSGMIKVITSLTEKDSGTLLDWEGKNIPW 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 94/250 (38%)
adh_short 4..209 CDD:278532 83/212 (39%)
zgc:158868NP_001074098.1 carb_red_sniffer_like_SDR_c 9..258 CDD:187586 94/250 (38%)
adh_short 9..220 CDD:278532 83/212 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1611
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D1390068at2759
OrthoFinder 1 1.000 - - FOG0000614
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100338
Panther 1 1.100 - - O PTHR43544
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X192
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.790

Return to query results.
Submit another query.