Sequence 1: | NP_001285012.1 | Gene: | sni / 31761 | FlyBaseID: | FBgn0030026 | Length: | 247 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001186700.1 | Gene: | RDH5 / 5959 | HGNCID: | 9940 | Length: | 318 | Species: | Homo sapiens |
Alignment Length: | 201 | Identity: | 58/201 - (28%) |
---|---|---|---|
Similarity: | 91/201 - (45%) | Gaps: | 21/201 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 ILITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKELEDLAKNHSNIHILEIDLRNFDAYD 68
Fly 69 KLVADIEGVTKDQGLNVLFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIMLAKACLPLLKKAA 133
Fly 134 KANESQPMGVGRAAIINMSSILGSIQGNTDGGMYAYRTSKSALNAATKSLSVDLYPQRIMCVSLH 198
Fly 199 PGWVKT 204 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sni | NP_001285012.1 | carb_red_sniffer_like_SDR_c | 4..247 | CDD:187586 | 58/201 (29%) |
adh_short | 4..209 | CDD:278532 | 58/201 (29%) | ||
RDH5 | NP_001186700.1 | type2_17beta_HSD-like_SDR_c | 30..306 | CDD:187665 | 58/201 (29%) |
PRK08017 | 31..308 | CDD:181198 | 58/201 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0.928771 | Normalized mean entropy | S2670 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.860 |