DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and RDH5

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001186700.1 Gene:RDH5 / 5959 HGNCID:9940 Length:318 Species:Homo sapiens


Alignment Length:201 Identity:58/201 - (28%)
Similarity:91/201 - (45%) Gaps:21/201 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKELEDLAKNHSNIHILEIDLRNFDAYD 68
            :.||||:.|.|..|.   |.|.|....:..:|.....|::|:.:|.  |.:|...:|:.:..:..
Human    31 VFITGCDSGFGRLLA---LQLDQRGFRVLASCLTPSGAEDLQRVAS--SRLHTTLLDITDPQSVQ 90

  Fly    69 KLVADIEGVTKDQGLNVLFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIMLAKACLPLLKKAA 133
            :....:|...|:.||..|.||||:|........:...:....|..||:.||.:..|.||||::| 
Human    91 QAAKWVEMHVKEAGLFGLVNNAGVAGIIGPTPWLTRDDFQRVLNVNTMGPIGVTLALLPLLQQA- 154

  Fly   134 KANESQPMGVGRAAIINMSSILGSIQGNTDGGMYAYRTSKSALNAATKSLSVDLYPQRIMCVSLH 198
                       |..:||::|:||.:..|..|    |..||..|.|.:.||..|:....|....:.
Human   155 -----------RGRVINITSVLGRLAANGGG----YCVSKFGLEAFSDSLRRDVAHFGIRVSIVE 204

  Fly   199 PGWVKT 204
            ||:.:|
Human   205 PGFFRT 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 58/201 (29%)
adh_short 4..209 CDD:278532 58/201 (29%)
RDH5NP_001186700.1 type2_17beta_HSD-like_SDR_c 30..306 CDD:187665 58/201 (29%)
PRK08017 31..308 CDD:181198 58/201 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.928771 Normalized mean entropy S2670
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.