DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and zgc:112146

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001017731.1 Gene:zgc:112146 / 550426 ZFINID:ZDB-GENE-050417-237 Length:256 Species:Danio rerio


Alignment Length:257 Identity:87/257 - (33%)
Similarity:143/257 - (55%) Gaps:20/257 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SILITGCNRGLGLGLVKALLNLPQPPQH---LFTTCRNRE--QAKELEDLAKNHSN-IHILEIDL 61
            |.|:||.||||||.:||.||.     .|   :|..||:.:  .::.|.:||:.|.. :.:::.|:
Zfish     8 SALVTGANRGLGLEMVKQLLE-----AHCSKVFAACRDPDGPNSEVLRELARKHLGVVTLVKHDI 67

  Fly    62 RNFDAYDKLVADIEGVTKDQGLNVLFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIMLAKACL 126
            .:..:..:....:..:..::|||:|.|||.|.|:...:||. .:::.:...||.:.|:.:.:..|
Zfish    68 ADPSSIKESAEKVGSLLGEKGLNLLVNNAAILPQKTMLTAT-VEDMHNAFNTNVIGPLFVIREYL 131

  Fly   127 PLLKKAAKANESQPMGVGRAAIINMS------SILGSIQGNTDGGMYAYRTSKSALNAATKSLSV 185
            |.|:.||||:....|...:||:||:|      |::.|::....  .:.|..||:.||..|...:.
Zfish   132 PYLRAAAKASGKPGMSSCKAAVINISTDSASMSMIPSMKDPFP--FFPYSISKAGLNMLTVYTAR 194

  Fly   186 DLYPQRIMCVSLHPGWVKTDMGGSSAPLDVPTSTGQIVQTISKLGEKQNGGFVNYDGTPLAW 247
            ||....|:|:|:|||||:||||.:.|.||...|...:::.|..|.||::||||:|.|..:.|
Zfish   195 DLKADEILCISIHPGWVRTDMGTNEATLDTRESVEGMLRVIGSLTEKESGGFVDYTGKTMPW 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 85/254 (33%)
adh_short 4..209 CDD:278532 71/216 (33%)
zgc:112146NP_001017731.1 carb_red_sniffer_like_SDR_c 9..256 CDD:187586 85/254 (33%)
adh_short 9..218 CDD:278532 71/216 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D1390068at2759
OrthoFinder 1 1.000 - - FOG0000614
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100338
Panther 1 1.100 - - O PTHR43544
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X192
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.