DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and RGD1561812

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:XP_038936531.1 Gene:RGD1561812 / 503146 RGDID:1561812 Length:249 Species:Rattus norvegicus


Alignment Length:148 Identity:34/148 - (22%)
Similarity:69/148 - (46%) Gaps:22/148 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIMLAKACLPLLKKAAKANESQPMGVGRAAIIN 150
            |..||||:..:.....:..|:....|..|.:..|.:..:.:|.::||            |..::|
  Rat    49 LVTNAGISIPTGPSEWLNKQDFASVLDVNLLGVIEVTLSMVPSVRKA------------RGPVVN 101

  Fly   151 MSSILGSIQGNTDGGMYAYRTSKSALNAATKSLSVDLYPQRIMCVSLHPGWVKTDMGGSSAPLDV 215
            ::|::..:  ::.||  .|..||..:.|.:.||..:|....:....:.||:.:|:|..|:    :
  Rat   102 IASVMDRV--SSFGG--GYCISKYGVEAFSDSLRRELSYFGVKVAIVGPGFFRTNMSNSA----I 158

  Fly   216 PTSTGQIV--QTISKLGE 231
            .:|..|::  :|.|::.|
  Rat   159 LSSNFQMLWDETSSEVRE 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 34/148 (23%)
adh_short 4..209 CDD:278532 28/122 (23%)
RGD1561812XP_038936531.1 NADB_Rossmann <48..238 CDD:419666 34/148 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1390068at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.