DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and sro

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster


Alignment Length:212 Identity:65/212 - (30%)
Similarity:92/212 - (43%) Gaps:40/212 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILITGCNRGLGLGLVKALLNLPQPPQHLFTTCRN--REQAKELEDLAK---NHSNIHILEIDLRN 63
            :|||||:.|||..:  |:.........:.:.|.|  .|.||.|:.||.   ..|.:|.||:||..
  Fly    29 VLITGCDSGLGHSM--AVYCHESLHMTVISCCHNIKSEGAKLLQGLASAKDGLSRMHTLELDLLE 91

  Fly    64 FDA---YDKLVADIEGVTKDQGLNVLFNNAGIA-------PKSARITAVRSQELLDTLQTNTVVP 118
            .|:   ..:.:.||........|..|.||||:.       ..:.:|.|..:..||.|::      
  Fly    92 PDSIRLVHRQLRDILAKDPSYRLTALINNAGVMCFGEFEWQLTEQIEAQINCNLLGTMR------ 150

  Fly   119 IMLAKACLPLLKKAAKANESQPMGVGRAAIINMSSILGSIQGNTDGGMYAYRTSKSALNAATKSL 183
              |....||||::..          ||  |||::|..| :|.....|.||  .||:||...|.||
  Fly   151 --LTHELLPLLRQQQ----------GR--IINVTSHCG-LQALPALGPYA--ASKAALRFWTDSL 198

  Fly   184 SVDLYPQRIMCVSLHPG 200
            .|:|....:..|:..||
  Fly   199 RVELQQYGMEVVNFIPG 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 65/212 (31%)
adh_short 4..209 CDD:278532 65/212 (31%)
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 65/212 (31%)
adh_short 28..229 CDD:278532 65/212 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.928771 Normalized mean entropy S2670
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.