DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and CG7601

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_651717.1 Gene:CG7601 / 43502 FlyBaseID:FBgn0027583 Length:326 Species:Drosophila melanogaster


Alignment Length:253 Identity:64/253 - (25%)
Similarity:102/253 - (40%) Gaps:58/253 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILITGCNRGLGLGLVKALLNLPQPPQHLF--TTCR---NREQAKELEDLAKNHSNIH-------- 55
            :||||.:.|||..|.           |:|  ..||   ...:.:|||.:.|:...:.        
  Fly    56 VLITGASSGLGESLA-----------HVFYRAGCRVILAARRTQELERVKKDLLALDVDPAYPPT 109

  Fly    56 ILEIDLRNFDAYDKLVADIEGVTKDQGLNVLFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIM 120
            :|.:||...::..:.|..:..|...  :::|.||.||:.: |.:.:......|..:..|....:.
  Fly   110 VLPLDLAELNSIPEFVTRVLAVYNQ--VDILINNGGISVR-ADVASTAVDVDLKVMVVNYFGSVA 171

  Fly   121 LAKACLPLLKKAAKANESQPMGVGRAAIINMSSILGSIQGN-TDGGMYAYRTSKSALNAATKSLS 184
            |.||.||.:.|         .|.|....|:      |:||. ......||..||.|:.|...||.
  Fly   172 LTKALLPSMVK---------RGSGHICFIS------SVQGKFAIPQRAAYSASKHAMQAFADSLR 221

  Fly   185 VDLYPQRI--MCVSLHPGWVKTDM--------GGSSAPLDVPTSTGQIVQTISKLGEK 232
            .::..:.|  .|||  ||:::|.:        |.|...:|..|:.|   .:..||.|:
  Fly   222 AEVANKNINVSCVS--PGYIRTQLSLNALTGSGSSYGKVDETTAKG---MSPDKLAER 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 64/253 (25%)
adh_short 4..209 CDD:278532 57/228 (25%)
CG7601NP_651717.1 11beta-HSD1_like_SDR_c 51..310 CDD:187593 64/253 (25%)
PRK06181 53..314 CDD:235726 64/253 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435195
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.