DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and CG5590

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_651578.1 Gene:CG5590 / 43325 FlyBaseID:FBgn0039537 Length:412 Species:Drosophila melanogaster


Alignment Length:211 Identity:47/211 - (22%)
Similarity:91/211 - (43%) Gaps:31/211 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SILITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKEL--------EDLAKNHSNIHILEI 59
            ::.|||.:||:|..:.   |...:...::....:..|...:|        |::.|.....:...:
  Fly    11 TLFITGASRGIGKEIA---LKAARDGANIVVAAKTAEPHPKLPGTIYSAAEEIEKAGGKAYPCVV 72

  Fly    60 DLRNFDAYDKLVADIEGVTKDQGLNVLFNNA-GIAPKSARITAVRSQELLDTLQTNTVVPIMLAK 123
            |:|  |......|....|.|..|::::.||| .|:..:...|.::..:|:..:  ||....:::|
  Fly    73 DVR--DEQQVRSAVEAAVAKFGGIDIVINNASAISLTNTPDTDMKRYDLMHNI--NTRGTFLVSK 133

  Fly   124 ACLPLLKKAAKANESQPMGVGRAAIINMSSILGSIQGNTDGGMYAYRTSKSALNAATKSLSVDLY 188
            .|||.|||:           ..|.|:|:|..| |::....|...||..:|..::.....::.:..
  Fly   134 VCLPYLKKS-----------NHAHILNISPPL-SMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFK 186

  Fly   189 PQRIMCVSLHPGWVKT 204
            .:.|   |::..|.:|
  Fly   187 DEGI---SVNALWPRT 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 47/210 (22%)
adh_short 4..209 CDD:278532 47/210 (22%)
CG5590NP_651578.1 FabG 5..245 CDD:223959 47/211 (22%)
PRK08278 7..277 CDD:181349 47/211 (22%)
SCP2 317..406 CDD:280250
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435193
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.