DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and CG3301

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001287440.1 Gene:CG3301 / 42528 FlyBaseID:FBgn0038878 Length:250 Species:Drosophila melanogaster


Alignment Length:240 Identity:54/240 - (22%)
Similarity:90/240 - (37%) Gaps:62/240 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKELEDL-----AKNHSNIHILEIDLRN- 63
            ::||.:.|:|....:.|:    ....:......||  |.|:|:     |...:..|....|:.| 
  Fly    10 VVTGASAGIGAACCRDLV----AKGMVVVGLARRE--KVLQDIKSSLPADQAARFHTRPCDVSNE 68

  Fly    64 ------FDAYDKLVADIEGVTKDQGLNVLFNNAGIAPKSARITAVRSQELLDTLQTNTV-----V 117
                  |...|:.:.         |.:||.|||||         :|...:.|...:..|     |
  Fly    69 QQVIDTFAWIDRTLG---------GADVLVNNAGI---------IRQMNITDPENSADVRAILDV 115

  Fly   118 PIMLAKAC-----LPLLKKAAKANESQPMGVGRAAIINMSSILGSIQGNTDG-GMYAYRTSKSAL 176
            .::....|     |.|.::  |.|:      |...:||  |::|......:| .:..|..||.|:
  Fly   116 NVLGVTWCTRQWFLSLQRR--KVND------GHVVVIN--SVVGHSVPAVEGFSLNMYAPSKHAI 170

  Fly   177 NAATKSLSVDLYPQ--RIMCVSLHPGWVKTDM---GGSSAPLDVP 216
            .|.|:.|..:...:  :....|:.||.|.|::   |....|..:|
  Fly   171 TALTEILRQEFIKKGTQTKITSISPGVVATEIFEAGSWEQPTGMP 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 54/240 (23%)
adh_short 4..209 CDD:278532 52/231 (23%)
CG3301NP_001287440.1 YdfG 1..250 CDD:226674 54/240 (23%)
NADB_Rossmann 1..245 CDD:304358 54/240 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435179
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.