DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and CG31546

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster


Alignment Length:246 Identity:58/246 - (23%)
Similarity:92/246 - (37%) Gaps:98/246 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILITGCNRGLG---------LGLVKALL--------------------------NLPQPPQHLFT 33
            :||||...|:|         ||...||:                          :|.:||     
  Fly    16 VLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYGIAGDLLKPP----- 75

  Fly    34 TCRNREQAKELEDLAKNHSNIHILEIDLRNFDAYDKLVADIEGVTKDQGLNVLFNNAGIAPKSAR 98
                     |:|.:|:                   |.....||     .|:||.|.|||.|..  
  Fly    76 ---------EIECIAR-------------------KTTERYEG-----KLDVLVNGAGIMPTG-- 105

  Fly    99 ITAVRSQEL---LDTLQTNTVVPIMLAKACLPLLKKAAKANESQPMGVGRAAIINMSSILGSIQG 160
              .::|.||   ...::.|......|.|..||.|.:.            :.:|:|:||:.|.   
  Fly   106 --TLQSTELACFTHVMEANVRSGFYLTKLLLPQLLQC------------KGSIVNVSSVCGL--- 153

  Fly   161 NTDGGMYAYRTSKSALNAATKSLSVDLYPQRIMCVSLHPGWVKTDM---GG 208
            .....:.||..||:|::..|:||::||.||.:...:::||.::|::   ||
  Fly   154 RAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVIRTNLQKAGG 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 58/246 (24%)
adh_short 4..209 CDD:278532 58/246 (24%)
CG31546NP_730973.1 fabG 9..257 CDD:235975 58/246 (24%)
NADB_Rossmann 11..261 CDD:304358 58/246 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435189
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.