DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and CG31549

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001262292.1 Gene:CG31549 / 40689 FlyBaseID:FBgn0051549 Length:257 Species:Drosophila melanogaster


Alignment Length:212 Identity:59/212 - (27%)
Similarity:97/212 - (45%) Gaps:30/212 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKELED--LAKNHSNIHILEIDLRNFDA 66
            |::||.:.|:|   ..|.::|.:....|....||.|:.||..|  :|...:....|:.|:..   
  Fly     9 IIVTGASSGIG---ASAAVHLAKLGGLLVIVGRNEEKLKETADNIVAAGGATPLELQADMTK--- 67

  Fly    67 YDKLVADIEGVT--KDQGLNVLFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIMLAKACLPLL 129
             :..|..|.|.|  |...::||.|||||. ::..|.|...::....:.||......|.....|.|
  Fly    68 -EAEVQQIVGATLAKHGRIDVLVNNAGIL-ETGSIEATSLEQFDRLMNTNVRSLYQLTMLATPEL 130

  Fly   130 KKAAKANESQPMGVGRAAIINMSSILGSIQGNTDGGMYAYRTSKSALNAATKSLSVDLYPQRIMC 194
            .| .|.|           |:|:||:.|.   ....|:.||..||:|::..|..::::|.|:.:..
  Fly   131 VK-TKGN-----------IVNVSSVCGL---RAFPGVLAYNVSKAAVDQFTACIALELAPKGVRV 180

  Fly   195 VSLHPGWVKTDM---GG 208
            .:::||.:.||:   ||
  Fly   181 NAVNPGVIVTDIHKRGG 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 59/212 (28%)
adh_short 4..209 CDD:278532 59/212 (28%)
CG31549NP_001262292.1 NADB_Rossmann 4..254 CDD:304358 59/212 (28%)
fabG 4..251 CDD:235975 59/212 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435120
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.