DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and CG8757

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_648664.2 Gene:CG8757 / 39528 FlyBaseID:FBgn0036380 Length:252 Species:Drosophila melanogaster


Alignment Length:218 Identity:48/218 - (22%)
Similarity:83/218 - (38%) Gaps:44/218 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKELED--LAKNHSNIHILEIDLRNFD-- 65
            :::|.:.|:|....:||:........|   .|..|:.::|..  ..:..|.:|.::.|:...|  
  Fly    10 VVSGASAGIGAACTRALIGAGMIVVGL---ARRHERVEKLRSGLSLEQQSRLHAIKCDITQEDQV 71

  Fly    66 --AYDKLVADIEGVTKDQGLNVLFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIMLAKACLPL 128
              |:|.....:.||      :||.:||||..............:..|::||.:..:...:.....
  Fly    72 LKAFDWTCRQLGGV------DVLVSNAGIIGTGELSERDDGPAMRSTIETNIMGTVYCVRESFRS 130

  Fly   129 LKKAAKANESQPMGVGRAAIINMSSILGSIQGNTD---GGMYAYRTSKSALNAATKSLSVDLYPQ 190
            :|:  :..|      |...|:|  |:.|....|..   ..:..|..:|.||.|..     ::|.|
  Fly   131 MKR--RGTE------GHVVIVN--SVAGYQVPNLGPQLPSLNIYPATKFALRAMN-----EIYRQ 180

  Fly   191 ---------RIMCVSLHPGWVKT 204
                     |:..||  ||.|.|
  Fly   181 EFQRHKTAVRVSTVS--PGIVDT 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 48/218 (22%)
adh_short 4..209 CDD:278532 48/218 (22%)
CG8757NP_648664.2 YdfG 1..252 CDD:226674 48/218 (22%)
NADB_Rossmann 1..247 CDD:304358 48/218 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435181
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.