DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and CG10672

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_647946.1 Gene:CG10672 / 38598 FlyBaseID:FBgn0035588 Length:317 Species:Drosophila melanogaster


Alignment Length:204 Identity:52/204 - (25%)
Similarity:87/204 - (42%) Gaps:26/204 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKELEDLAKNHSNIHILEIDLRNFDAYDK 69
            ::|....|:|..:.|.|..  .....:.::.:.:.....|.:|.|.:.|:|.|:..:.  :..|:
  Fly    75 VVTASTDGIGFAIAKRLAE--DGAAVVISSRKQKNVDSALAELRKLNLNVHGLKCHVS--EPEDR 135

  Fly    70 LVADIEGVTKDQGLNVLFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIMLAKACLPLLKKAAK 134
            .....|.::|...||:|.:||...|....:.....:........|.....:|||..||||::  :
  Fly   136 KQLFEETISKFGKLNILVSNAATNPAVGGVLECDEKVWDKIFDVNVKSSYLLAKEALPLLRQ--Q 198

  Fly   135 ANESQPMGVGRAAIINMSSILG----SIQGNTDGGMYAYRTSKSALNAATKSLSVDLYPQRIMCV 195
            .|.|         |:.:|||.|    .:.|       ||..||:||...||:.:.||.|:.|...
  Fly   199 KNSS---------IVFVSSIAGYDAFELLG-------AYSVSKTALIGLTKAAAKDLAPEGIRVN 247

  Fly   196 SLHPGWVKT 204
            .|.||.::|
  Fly   248 CLAPGVIRT 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 52/204 (25%)
adh_short 4..209 CDD:278532 52/204 (25%)
CG10672NP_647946.1 NADB_Rossmann 67..317 CDD:304358 52/204 (25%)
fabG 67..316 CDD:235975 52/204 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435196
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.