DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and CG9150

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_608991.2 Gene:CG9150 / 33856 FlyBaseID:FBgn0031775 Length:251 Species:Drosophila melanogaster


Alignment Length:213 Identity:47/213 - (22%)
Similarity:91/213 - (42%) Gaps:30/213 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKEL-EDLAKN-HSNIHILEIDLRNFD-- 65
            ::||.:.|:|....:|::.   ....:....|...:.||| |.|.:. .:|......|:...|  
  Fly    10 VVTGASGGIGAACARAMIG---AGLRVVGLARREAKLKELRESLPRELQANFIPRRCDVSKEDQV 71

  Fly    66 --AYDKLVADIEGVTKDQGLNVLFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIMLAKACLPL 128
              ::|.:..::||.      :||.|||||..::..:|...:|:|.:.:.||.:..|...:.....
  Fly    72 QSSFDWIERELEGA------DVLLNNAGITRETELVTPSNTQKLKEVIDTNVMGVIWCTREAFNN 130

  Fly   129 LKKAAKANESQPMGVGRAA---IINMSSILGSIQGNTDGGMYAYRTSKSALNAATKSL--SVDLY 188
            :|:  :..|...:.:...|   ::|...:|.|..        .|..:|.|:.|.|::.  ...|:
  Fly   131 MKR--RGGEGHVLIINSIAGHQVLNFIDVLPSFN--------IYPATKFAITAITETYRQEFQLH 185

  Fly   189 PQRIMCVSLHPGWVKTDM 206
            ..:|....:.||.|.|::
  Fly   186 SNKIRVTGICPGAVNTNI 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 47/213 (22%)
adh_short 4..209 CDD:278532 47/213 (22%)
CG9150NP_608991.2 YdfG 1..251 CDD:226674 47/213 (22%)
NADB_Rossmann 1..247 CDD:304358 47/213 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435180
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.