DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and CG40486

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001036311.2 Gene:CG40486 / 3355162 FlyBaseID:FBgn0263830 Length:247 Species:Drosophila melanogaster


Alignment Length:263 Identity:53/263 - (20%)
Similarity:101/263 - (38%) Gaps:63/263 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LITGCNRGLGLGLVKALLNLPQPPQHLFTT-------CRNREQAKELEDL--AKNHSNIHILEID 60
            ::||.:.|:|..:.:          ||.:.       .|..::.|.:::.  .:....:|.:..|
  Fly    10 VVTGASSGIGAAVAR----------HLVSAGVIVVGLARRVDRMKAIKEQLPPELQGRLHAIHCD 64

  Fly    61 LRNFD----AYDKLVADIEGVTKDQGLNVLFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIML 121
            :.:.|    |:|.:...:      .|.::|.||||.. ...::..:..::|...|..|    :|.
  Fly    65 VEDLDSVTAAFDWIEEQL------GGCDILVNNAGCL-NPGQLLTLELEQLQQVLNVN----LMG 118

  Fly   122 AKACLPLLKKAAKANESQPMGVGRAAIINMSSILGSIQGNTDGG----MYAYRTSKSALNAATKS 182
            ...|   .::|.::.:.:.:. |...:||  |:.|....|..|.    :..|..:|..:.|..:.
  Fly   119 VVIC---TRRAFRSMQQREVD-GHVILIN--SLTGRNIINPPGDELQVLNMYPLTKHGVTAMLEV 177

  Fly   183 LSVDL--YPQRIMCVSLHPGWVKTDM---GGSSAPLDVP----------TSTGQIVQ----TISK 228
            |..:|  :..:|...|:.||...|::   |....|:..|          ..|...||    ||..
  Fly   178 LRQELRGFKTKIKVTSITPGVTDTEILPSGYGILPMLKPDDIAAGIMYVLGTPAHVQVHELTIKP 242

  Fly   229 LGE 231
            |||
  Fly   243 LGE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 53/263 (20%)
adh_short 4..209 CDD:278532 43/225 (19%)
CG40486NP_001036311.2 YdfG 1..247 CDD:226674 53/263 (20%)
NADB_Rossmann 1..242 CDD:304358 50/258 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435182
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.