DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and CG9360

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_572746.1 Gene:CG9360 / 32128 FlyBaseID:FBgn0030332 Length:251 Species:Drosophila melanogaster


Alignment Length:226 Identity:57/226 - (25%)
Similarity:96/226 - (42%) Gaps:36/226 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LITGCNRGLGLGLVKALLNLPQPPQHLFTT--CRNREQAKELEDL--AKNHSNIHILEIDLRN-- 63
            ::||.:.|:|....|.|::     :.|...  .|..::.:||:..  |...|..|..:.|:..  
  Fly    10 VVTGASSGIGAACCKDLVS-----KGLVVVGLARREDRLQELKASLPADQASRFHGRKCDVSQEQ 69

  Fly    64 --FDAYDKLVADIEGVTKDQGLNVLFNNAGIAPKSARIT-AVRSQELLDTLQTNTVVPIMLAKAC 125
              .||:..:.|.:.|.      :||.|||||......|| .....:|...|.||    ::....|
  Fly    70 EVIDAFAWIDATLGGA------DVLVNNAGIVRLGVGITHEGNGADLRAILDTN----VLGVSWC 124

  Fly   126 LPLLKKAAKANESQPMGVGRAAIINMSSILGSIQGNTDG---GMYAYRTSKSALNAATKSLSVDL 187
               .::|.|:.:.:.:..|...|:|  |:.|....|..|   |||:  .||.|:.|.|:.|..:.
  Fly   125 ---TREAFKSLKRRNVNDGHILIVN--SVAGHRVINNPGITMGMYS--PSKYAVTALTEVLRQEF 182

  Fly   188 YPQRIM--CVSLHPGWVKTDMGGSSAPLDVP 216
            :..:..  ..|:.||.|.|::....|.:.:|
  Fly   183 HNNKTQTKITSISPGAVDTEIIDKEALVGIP 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 57/226 (25%)
adh_short 4..209 CDD:278532 55/217 (25%)
CG9360NP_572746.1 YdfG 1..250 CDD:226674 57/226 (25%)
NADB_Rossmann 1..246 CDD:304358 57/226 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435177
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.