DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and CG10962

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_788887.1 Gene:CG10962 / 31824 FlyBaseID:FBgn0030073 Length:249 Species:Drosophila melanogaster


Alignment Length:235 Identity:56/235 - (23%)
Similarity:99/235 - (42%) Gaps:39/235 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKELEDL--AKNHSNIHILEIDLRNFDAY 67
            :|:|.:.|:|....:.|:   .....:....|..::.::|...  |:.....|     ....|..
  Fly    10 VISGASSGIGAACARLLV---AAGLQVVGLARRTDRLEQLRQSLPAEQRMRFH-----QHKCDVS 66

  Fly    68 DKLVAD--IEGVTKD-QGLNVLFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIMLAKACLPLL 129
            .:|..|  .|.:.|: .|::||.|||||. ...::..:.::::.:.||||.:..|...|.....:
  Fly    67 QELQVDTAFEWIEKELGGIDVLINNAGIV-LGGQLIDMPTKDINNILQTNLMGSIYCTKLAASSM 130

  Fly   130 KKAAKANESQPMGVGRAAIINMSS-ILGSIQGNTDGGMYAYRTSKSALNAATKSLSVDLYPQ--R 191
            ::...|        |....:|.:: :.|......|..:.||..||.||.|..:....:|..|  :
  Fly   131 RRRQVA--------GHLIFVNSTAGVAGYKPDPADESLNAYTPSKFALTAVQEICRQELINQGSK 187

  Fly   192 IMCVSLHPGWVKTDMGGSSAPLDVPTSTGQIVQTISKLGE 231
            |...|::||||.|::        ||.      :|.:||||
  Fly   188 IKTTSINPGWVATEI--------VPD------ETKAKLGE 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 56/235 (24%)
adh_short 4..209 CDD:278532 49/211 (23%)
CG10962NP_788887.1 YdfG 1..249 CDD:226674 56/235 (24%)
NADB_Rossmann 1..243 CDD:304358 56/235 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435176
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.