DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and CG3699

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_569875.2 Gene:CG3699 / 31046 FlyBaseID:FBgn0040349 Length:251 Species:Drosophila melanogaster


Alignment Length:244 Identity:66/244 - (27%)
Similarity:106/244 - (43%) Gaps:64/244 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKELEDLAKNHSNIHILEIDLRNFDAYD 68
            :::||.:.|:|..:.:.|.               ||.| .|..:.:|.:|:...:..|:...| :
  Fly     8 VIVTGASSGIGAAIAQVLA---------------REGA-TLALVGRNVANLEATKKSLKGTQA-E 55

  Fly    69 KLVADIEGVTKDQG------------LNVLFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIML 121
            .:|||   ||||..            ::||.|||||..|...|. :..:|....|.||....|:|
  Fly    56 IVVAD---VTKDADAIVQQTLAKFGRIDVLVNNAGILGKGGLID-LDIEEFDAVLNTNLRGVILL 116

  Fly   122 AKACLPLLKKAAKANESQPMGVGRAAIINMSSILGSIQGNTDGGMYAYRTSKSALNAATKSLSVD 186
            .||.||.|.|.            :.|::|:||..|.   ....|..:|..||:||:..||.::::
  Fly   117 TKAVLPHLLKT------------KGAVVNVSSCAGI---RPFAGALSYGVSKAALDQFTKIVALE 166

  Fly   187 LYPQRIMCVSLHPGWVKTDMGGSSAPLDVPTSTGQIVQTISKLGEKQNG 235
            :.||.:...|::||:|.|:                |.:.|..:.|:.||
  Fly   167 MAPQGVRVNSVNPGFVVTN----------------IHRNIGIVDEEYNG 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 66/244 (27%)
adh_short 4..209 CDD:278532 61/216 (28%)
CG3699NP_569875.2 fabG 1..244 CDD:235546 66/244 (27%)
NADB_Rossmann 3..248 CDD:304358 66/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435118
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.