DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and CG13377

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001259089.1 Gene:CG13377 / 30972 FlyBaseID:FBgn0261446 Length:330 Species:Drosophila melanogaster


Alignment Length:216 Identity:44/216 - (20%)
Similarity:86/216 - (39%) Gaps:46/216 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILITGCNRGLGLGLVKALLNL-------------PQPPQHLFTTCRNREQAKELEDLAKNHSNIH 55
            :|||..:..|||.|...|.|.             ..|.:.|....:.||.::  |.:|   ..|.
  Fly    48 VLITSADTALGLQLCTHLANKGYRVFAGMKEAQDSLPAKLLCGWMKIREYSE--EPIA---GTII 107

  Fly    56 ILEIDLRNFDAYDK--------LVADIEGVTKDQGLNVLFNNAGIAPKSARITAVRSQELLDTLQ 112
            .:.:|:...|...:        |.||      ::|:..:.|.:|...: .::.:...|:....|:
  Fly   108 PMRLDVTREDVLREATVIIGANLNAD------ERGIAAVINTSGSVFR-GQVESQNVQQWEHMLR 165

  Fly   113 TNTVVPIMLAKACLPLLKKAAKANESQPMGVGRAAIINMSSILGSIQGNTDG-GMYAYRTSKSAL 176
            ||.:..:.:|||.:..|:..            |..::.:..:.|......:| |:.|:..|:.|:
  Fly   166 TNILGTLRVAKAFVCFLRPT------------RGRLLYLGGVSGGGNARNEGDGLVAFNASRVAV 218

  Fly   177 NAATKSLSVDLYPQRIMCVSL 197
            :...:.|..:|:|..:..|:|
  Fly   219 DKCAEELRKELHPYGVSVVAL 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 44/216 (20%)
adh_short 4..209 CDD:278532 44/216 (20%)
CG13377NP_001259089.1 adh_short 46..246 CDD:278532 44/216 (20%)
NADB_Rossmann 46..>237 CDD:304358 42/212 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435134
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1390068at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.