DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and dhs-31

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_001255457.1 Gene:dhs-31 / 188051 WormBaseID:WBGene00011424 Length:254 Species:Caenorhabditis elegans


Alignment Length:249 Identity:85/249 - (34%)
Similarity:128/249 - (51%) Gaps:7/249 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SILITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKELEDLAKNHSNIHILEIDLRNFDAY 67
            ::.|||.|||:|||:|:.||.:.: .:.:....||.|.|.||.:|||..:.:|.:.:|:.|.:..
 Worm     5 TVFITGANRGIGLGIVRKLLKVSE-IEVIIAGARNLEAANELRELAKADNRLHAITVDVANDERL 68

  Fly    68 DKLVADIEGVTKDQGLNVLFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIMLAKACLPLLKKA 132
            ...|..:|.:..|:|||:|.||||.........:...:..|.....|.|..:|.::..|||||||
 Worm    69 ANSVKQVESLVGDRGLNLLINNAGCYELYETTDSPSRKASLKCFDVNAVGSLMASQLFLPLLKKA 133

  Fly   133 AKANESQPMGVGRAAIINMSSILGS--IQG--NTDGGMYAYRTSKSALNAATKSLSVDLYPQRI- 192
            |.......:...||||:|:.|...|  :.|  ..:....||:.||.|:.:..:||:.|.....| 
 Worm   134 AAHTHITGLSASRAAILNIGSDCSSQFLNGTPTVNDVSIAYKMSKVAMLSFARSLASDFRTLNIP 198

  Fly   193 -MCVSLHPGWVKTDMGGSSAPLDVPTSTGQIVQTISKLGEKQNGGFVNYDGTPL 245
             :..::|||||.|:||||.|.:.|..|...||.:|.:|.....||......||:
 Worm   199 VLIATIHPGWVLTEMGGSDAEITVEESATDIVDSIERLNTSHQGGLFERKLTPM 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 85/248 (34%)
adh_short 4..209 CDD:278532 72/210 (34%)
dhs-31NP_001255457.1 adh_short 4..216 CDD:278532 72/211 (34%)
NADB_Rossmann 6..254 CDD:304358 85/248 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H71144
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53570
OrthoDB 1 1.010 - - D1390068at2759
OrthoFinder 1 1.000 - - FOG0000614
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100338
Panther 1 1.100 - - O PTHR43544
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X192
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.930

Return to query results.
Submit another query.