DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and dhs-20

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_505941.3 Gene:dhs-20 / 179590 WormBaseID:WBGene00000983 Length:342 Species:Caenorhabditis elegans


Alignment Length:248 Identity:69/248 - (27%)
Similarity:100/248 - (40%) Gaps:41/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SILITGCNRGLGLGLVK-----ALLNLPQPPQHLFTTCRNREQAKELEDLAKNHSNIHILEIDLR 62
            :||||||:.|.|..|.|     ..|        :|..|...|.||.||..:.| ..:..:.:|:.
 Worm    43 AILITGCDTGFGRELAKKCAKNGFL--------VFAGCLTTEAAKTLESESAN-PRLRTVPLDVS 98

  Fly    63 NFDAYDKLVADIEGVTKDQGLNVLF---NNAGIAPKSARITAVRSQELLDTLQTNTVVPIMLAKA 124
            ..::.:|.|   |.|.|..|.:.|:   |||||..........|..:....|..|.:..|.:.:|
 Worm    99 KDESVEKTV---EFVKKSLGNHKLWGVVNNAGIFSCYGPDDWCRMNDYKLALDVNCLGVIRVTQA 160

  Fly   125 CLPLLKKAAKANESQPMGVGRAAIINMSSILGSIQGNTDGGMYAYRTSKSALNAATKSLSVDLYP 189
            ...|: ||||         ||  |:.::|:.|.:.....|   .|..||....|....:..:||.
 Worm   161 FKKLV-KAAK---------GR--IVTVTSVNGRLSTPAAG---PYVVSKFGAAAYMDCIRQELYN 210

  Fly   190 QRIMCVSLHPGWVKTDMGGSSAPLD-VPTSTGQI-VQTISKLGEKQNGGFVNY 240
            ..:....|.||..:|.:....|.|. |.....|| .:|.::.||.    |.||
 Worm   211 FGVKVSILEPGIFRTPLLDEQAMLKRVDHVWTQIDDETRTEYGET----FKNY 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 69/247 (28%)
adh_short 4..209 CDD:278532 58/212 (27%)
dhs-20NP_505941.3 NADB_Rossmann 42..321 CDD:304358 69/248 (28%)
adh_short 42..230 CDD:278532 58/213 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1390068at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.