DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and dhs-2

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_491575.1 Gene:dhs-2 / 172183 WormBaseID:WBGene00000966 Length:368 Species:Caenorhabditis elegans


Alignment Length:211 Identity:52/211 - (24%)
Similarity:85/211 - (40%) Gaps:27/211 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SILITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKELEDLAK----NHSNIHILEIDLRN 63
            ::.||||:.|.|.||....|....|   :|..|...:..:.|...|:    |..::....:|:.:
 Worm    71 AVFITGCDSGFGRGLALKCLEQGMP---VFAGCLTEQGIESLSAEARKSIGNGRSLDAFLMDVTS 132

  Fly    64 FDAYDKLVADIEGVTKDQ-GLNVLFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIMLAKACLP 127
            .::..::...:|...:.. ||:.:.|||||..|......:...|.|.....|...||....|...
 Worm   133 DESVGEVAKRLEKKCEQYGGLHAVVNNAGITGKHIADDFLDINEYLKVANINLWGPIRTTMAVKK 197

  Fly   128 LLKKAAKANESQPMGVGRAAIINMSSILGSIQGNTDG--GMYAYRTSKSALNAATKSLSVDLYPQ 190
            |||||            |..::.::||...:     |  |:..|..||..::|....:..:|.|.
 Worm   198 LLKKA------------RGRVVTVASICARV-----GLPGLGPYSVSKYGVSAYCDVIRQELRPF 245

  Fly   191 RIMCVSLHPGWVKTDM 206
            .|....|.||:..|.:
 Worm   246 GISVHVLEPGFFNTPL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 52/210 (25%)
adh_short 4..209 CDD:278532 52/210 (25%)
dhs-2NP_491575.1 NADB_Rossmann 70..354 CDD:304358 52/211 (25%)
adh_short 70..261 CDD:278532 52/209 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1390068at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.