DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and bdh1b

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:XP_002937888.2 Gene:bdh1b / 100497276 XenbaseID:XB-GENE-22249057 Length:363 Species:Xenopus tropicalis


Alignment Length:242 Identity:59/242 - (24%)
Similarity:103/242 - (42%) Gaps:53/242 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILITGCNRGLGLGLVKALLNLPQPPQHLFTTC----RNREQAKELEDLAKNHSNIHILEIDLRNF 64
            :|||||:.|.|..|.|.|..|...   :|..|    :|...|:||:.:..:  .:|:.::::.|.
 Frog    78 VLITGCDTGFGFALAKHLHKLGFT---VFAGCLLKDKNGNGAEELQGMQSD--RMHVFQLNVCNE 137

  Fly    65 DAYDKLVADIE--GVTKDQGLNVLFNNAGIAP-KSARITAV-RSQELLDTLQTNTVVPIMLAKAC 125
            :...|.|..::  ....::||..:.|||||:. .....|.: :.:|::|.....||   .:.||.
 Frog   138 EEVAKAVEFVKQHQENPEKGLWGVVNNAGISTFGDVEFTTLDKYKEVMDVNLWGTV---RITKAF 199

  Fly   126 LPLLKKAAKANESQPMGVGRAAIINMSSILGSIQGNTDGGM-----YAYRTSKSALNAATKSLSV 185
            |||:::|.          ||...:          |:|.|.|     ..|..||..:.|.|..|..
 Frog   200 LPLIRQAK----------GRVVCV----------GSTLGRMCKPSRSCYSISKIGVEAFTGCLRQ 244

  Fly   186 DLYPQRIMCVSLHPGWVKTDMGGSSAPLDVPTSTGQIVQTISKLGEK 232
            ::|...:..:::       :.|...|..::.|..|     :.|.||:
 Frog   245 EMYQWGVKVINI-------EAGNFIAATELFTKEG-----VEKRGEE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 59/242 (24%)
adh_short 4..209 CDD:278532 53/217 (24%)
bdh1bXP_002937888.2 NADB_Rossmann 76..361 CDD:419666 59/242 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1390068at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.