DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and bdh1a

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:XP_002937878.1 Gene:bdh1a / 100495647 XenbaseID:XB-GENE-990740 Length:337 Species:Xenopus tropicalis


Alignment Length:205 Identity:48/205 - (23%)
Similarity:98/205 - (47%) Gaps:29/205 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SILITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQ----AKELEDLAKNHSNIHILEIDLRN 63
            ::|:|||:.|.|..|.|.|.|   ....::..|..:::    .|||:.:..:  .:..:::::..
 Frog    51 AVLVTGCDSGFGFSLAKHLHN---KGFIVYAGCLFKDKGEAGVKELDSMKSD--RMRTIQLNVVK 110

  Fly    64 FDAYDKLVADI-EGVTK-DQGLNVLFNNAGIAP-KSARITAVRSQELLDTLQTNTVVPIMLAKAC 125
            .|..|:.|..| |.:|. ::||..:.|||||:. .....|::.:.:  :..:.|....:.:.|||
 Frog   111 QDEVDRTVEIIRENLTNPEKGLWGVVNNAGISTFGEVEFTSMETYK--EVAEVNLWGTVRVTKAC 173

  Fly   126 LPLLKKAAKANESQPMGVGRAAIINMSSILGSIQGNTDGGMYAYRTSKSALNAATKSLSVDLYPQ 190
            |||:::|            :..::|:||:||.:   .:.....|..:|..:.|.:..|..:::|.
 Frog   174 LPLIRRA------------KGRVVNISSMLGRM---ANPARSPYCITKFGVEAFSDCLRYEMHPL 223

  Fly   191 RIMCVSLHPG 200
            .:....:.||
 Frog   224 GVKVSVVEPG 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 48/204 (24%)
adh_short 4..209 CDD:278532 48/204 (24%)
bdh1aXP_002937878.1 type2_17beta_HSD-like_SDR_c 50..335 CDD:187665 48/205 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1390068at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.