DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sni and LOC100360601

DIOPT Version :9

Sequence 1:NP_001285012.1 Gene:sni / 31761 FlyBaseID:FBgn0030026 Length:247 Species:Drosophila melanogaster
Sequence 2:XP_038944718.1 Gene:LOC100360601 / 100360601 RGDID:2321756 Length:277 Species:Rattus norvegicus


Alignment Length:282 Identity:66/282 - (23%)
Similarity:114/282 - (40%) Gaps:82/282 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAK------ELEDLAKNHSNIHILEID--- 60
            |:||.|:|:|..:.:.|..  :.|..:..|.|:..:.:      :.|.|:   ...|.|:||   
  Rat     9 LVTGANKGIGFAITRDLCR--KFPGDVVLTARDEARGRAAVQQLQAEGLS---PRFHQLDIDNPQ 68

  Fly    61 ----LRNFDAYDKLVADIEGVTKDQ-GLNVLFNNAGIAPKSA--------RITAVRSQ------- 105
                ||:|            :.|:. ||:||.||||||.|..        |..|:::.       
  Rat    69 SICALRDF------------LRKEYGGLDVLVNNAGIASKGTDLNHFHIQREAAMKTNFFGTQAV 121

  Fly   106 --ELLDTLQT-------NTVVPIMLAKACLPLLKKAAKA---NESQPMGVGRAAIINMSSILGSI 158
              |||..::|       ::::.:...|.|.|.|::..::   .|.:.:|:....:.:....:...
  Rat   122 CTELLPLIKTQGRVVNVSSLISLEALKNCSPELRQKFRSETITEEELVGLMNKFVEDAKEGVHEK 186

  Fly   159 QGNTDGGMYAYRTSKSALNAATKSLSVDLYPQR----IMCVSLHPGWVKTDMGGSSA-------- 211
            :|..:.   ||..||..:...::..:..|..:|    |:..:..||||:|||.|..|        
  Rat   187 EGWPNS---AYAVSKIGVTVLSRIYARKLNEERRGDKILLNACCPGWVRTDMAGPKATKSPEEGA 248

  Fly   212 --PL-------DVPTSTGQIVQ 224
              |:       |.....||.||
  Rat   249 ETPVYLALLTPDAEGPHGQFVQ 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sniNP_001285012.1 carb_red_sniffer_like_SDR_c 4..247 CDD:187586 66/282 (23%)
adh_short 4..209 CDD:278532 58/248 (23%)
LOC100360601XP_038944718.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 66/282 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D466834at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.