DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trxr-1 and TXNRD1

DIOPT Version :9

Sequence 1:NP_727251.1 Gene:Trxr-1 / 31760 FlyBaseID:FBgn0020653 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001087240.1 Gene:TXNRD1 / 7296 HGNCID:12437 Length:649 Species:Homo sapiens


Alignment Length:489 Identity:273/489 - (55%)
Similarity:340/489 - (69%) Gaps:7/489 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 SYDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQA 176
            |||||||:|||||.|||.||||...|.:|..||||.||| |||:||:||||||||||||||||||
Human   160 SYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTP-LGTRWGLGGTCVNVGCIPKKLMHQA 223

  Fly   177 SLLGEAVHEAAAYGWNVDEKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDSH 241
            :|||:|:.::..|||.|:|.:|.||.:::::|||||.|:||..||.||:|||.|.|..|.|:..|
Human   224 ALLGQALQDSRNYGWKVEETVKHDWDRMIEAVQNHIGSLNWGYRVALREKKVVYENAYGQFIGPH 288

  Fly   242 TLLAKLKSG-ERTITAQTFVIAVGGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGAGYIGL 305
            .:.|....| |:..:|:.|:||.|.||||..|||..||.|:|||||||...|||||||||.|:.|
Human   289 RIKATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVAL 353

  Fly   306 ECAGFLKGLGYEPTVMVRSIVLRGFDQQMAELVAASMEERGIPFLRKTVPLSVEKQD---DGKLL 367
            ||||||.|:|.:.|||||||:||||||.||..:...|||.||.|:|:.||:.||:.:   .|:|.
Human   354 ECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLR 418

  Fly   368 VKYKNVETGEEAEDVYDTVLWAIGRKGLVDDLNLPNAGVTVQK--DKIPVDSQEATNVANIYAVG 430
            |..::..:.|..|..|:||:.||||......:.|...||.:.:  .||||..:|.|||..|||:|
Human   419 VVAQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIG 483

  Fly   431 DIIYGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQFGADE 495
            ||:..|.||||||:.||||||:|||.|||.:.||::|.|||||||||...|||||.||::||.:.
Human   484 DILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEEN 548

  Fly   496 IEVFHGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTIN 560
            |||:|.|:.|.|:.||.:....||.|.:.....::||.|.|.:||.||||.||||||||.|||..
Human   549 IEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKK 613

  Fly   561 TLINTVGIHPTTAEEFTRLAITKRSGLDPTPASC 594
            .|.:|:||||..||.||.|::|||||.....|.|
Human   614 QLDSTIGIHPVCAEVFTTLSVTKRSGASILQAGC 647

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trxr-1NP_727251.1 TGR 113..595 CDD:273624 272/488 (56%)
NADB_Rossmann 115..>150 CDD:304358 23/34 (68%)
Pyr_redox 294..368 CDD:278498 45/76 (59%)
Pyr_redox_dim 468..577 CDD:280934 59/108 (55%)
TXNRD1NP_001087240.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
GRX_GRXh_1_2_like 68..148 CDD:239511
TGR 161..649 CDD:273624 272/488 (56%)
Pyr_redox 342..418 CDD:278498 44/75 (59%)
Pyr_redox_dim 521..631 CDD:280934 60/109 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 128 1.000 Domainoid score I5308
eggNOG 1 0.900 - - E1_COG1249
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.928771 Normalized mean entropy S1111
OMA 1 1.010 - - QHG57703
OrthoDB 1 1.010 - - D164705at33208
OrthoFinder 1 1.000 - - FOG0000578
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100956
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.680

Return to query results.
Submit another query.