DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trxr-1 and CG4199

DIOPT Version :9

Sequence 1:NP_727251.1 Gene:Trxr-1 / 31760 FlyBaseID:FBgn0020653 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001188537.1 Gene:CG4199 / 31174 FlyBaseID:FBgn0025628 Length:593 Species:Drosophila melanogaster


Alignment Length:411 Identity:86/411 - (20%)
Similarity:140/411 - (34%) Gaps:99/411 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 IVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQASLLGEA 182
            ||:|||.:| |.|.|.:........|.||                    |....|.:....:.:|
  Fly   183 IVVGGGPSG-AVAVETIRQEGFTGRLIFV--------------------CREDYLPYDRVKISKA 226

  Fly   183 VH-EAAAYGWNVDEKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDSHTLLAK 246
            :: |.....:..:|..|....:|.|.|.        ..::|...|::...||.            
  Fly   227 MNLEIEQLRFRDEEFYKEYDIELWQGVA--------AEKLDTAQKELHCSNGY------------ 271

  Fly   247 LKSGERTITAQTFVIAVGGRPRYPDIPG--------AVEYGITSDDLFSLDREPGKTLVVGAGYI 303
                  .:......:|.|.....|.|||        ..|...|...|.|:..| .:.:.:|:.:|
  Fly   272 ------VVKYDKIYLATGCSAFRPPIPGVNLENVRTVRELADTKAILASITPE-SRVVCLGSSFI 329

  Fly   304 GLECAGFLKGLGYEPTVMVR-SIVLR-GFDQQMAELVAASMEERGIPFLRKTVPLSVEKQDDGKL 366
            .||.|..|.......||:.| ::.|: .|..::.:.|....|:..:....::....:...:|||:
  Fly   330 ALEAAAGLVSKVQSVTVVGRENVPLKAAFGAEIGQRVLQLFEDNKVVMRMESGIAEIVGNEDGKV 394

  Fly   367 LVKYKNVETGEEAEDVYDTVLWAIGRKGLVDDLN---LPNAGVTVQKD-KIPVDSQEATNVANIY 427
                ..|...::.....|.::...|.|     ||   |..:||.|.:: .:.|.....:||.::|
  Fly   395 ----SEVVLVDDTRLPCDLLILGTGSK-----LNTQFLAKSGVKVNRNGSVDVTDFLESNVPDVY 450

  Fly   428 AVGDI----IYGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAV 488
            ..|||    |:|             |...|:..|..|...|......:     ..|.|:.:.:||
  Fly   451 VGGDIANAHIHG-------------LAHDRVNIGHYQLAQYHGRVAAI-----NMCGGVKKLEAV 497

  Fly   489 K-----QFGADEIEVFHGYYK 504
            .     .||.......||.||
  Fly   498 PFFFTLIFGKGIRYAGHGSYK 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trxr-1NP_727251.1 TGR 113..595 CDD:273624 86/411 (21%)
NADB_Rossmann 115..>150 CDD:304358 12/31 (39%)
Pyr_redox 294..368 CDD:278498 16/75 (21%)
Pyr_redox_dim 468..577 CDD:280934 10/42 (24%)
CG4199NP_001188537.1 Rieske_AIFL_N 59..154 CDD:239560
Pyr_redox_2 183..465 CDD:285266 72/351 (21%)
Pyr_redox 320..402 CDD:278498 17/85 (20%)
Reductase_C 505..577 CDD:291425 6/14 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464297
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.