DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or7a and Or98b

DIOPT Version :9

Sequence 1:NP_511081.1 Gene:Or7a / 31750 FlyBaseID:FBgn0030016 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_524540.4 Gene:Or98b / 43375 FlyBaseID:FBgn0039582 Length:383 Species:Drosophila melanogaster


Alignment Length:223 Identity:50/223 - (22%)
Similarity:81/223 - (36%) Gaps:60/223 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AVSTRVATKQEVPESRR--------AFRNLFNCFYALGMQAPDGSRPTTSSTWQRI------YAC 52
            ||:..:.|:    ||||        |:     ||...|:.|...|..:...::||.      :..
  Fly   108 AVAEMIVTR----ESRRDQFISAMYAY-----CFITAGLSACLMSPLSMLISYQRTGELQPKFPF 163

  Fly    53 FSVVMYVWQLLLVPTFFVISYRYMGGMEITQVLTSAQVAIDAVILPAKIVALAWNL-PLLRRAEH 116
            .||  |.|..:.:.. ::|||.:       .|..:..||:..|.:.....:|:.|| .|.:.|.|
  Fly   164 PSV--YPWDNMKLSN-YIISYFW-------NVCAALGVALPTVCVDTLFCSLSHNLCALFQIARH 218

  Fly   117 HLAALDAR-CREQEE--------FQLILDAVRF---------CNYLVWFYQICYAIYSSSTFVCA 163
            .:...:.| .:|..|        :.|.|:...|         |.::.....:|...|..|..:. 
  Fly   219 KMMHFEGRNTKETHENLKHVFQLYALCLNLGHFLNEYFRPLICQFVAASLHLCVLCYQLSANIL- 282

  Fly   164 FLLGQPP---YALYLPGLDWQRSQMQFC 188
                ||.   ||.:...:..|.|...||
  Fly   283 ----QPALLFYAAFTAAVVGQVSIYCFC 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or7aNP_511081.1 7tm_6 80..394 CDD:251636 28/131 (21%)
Or98bNP_524540.4 7tm_6 59..372 CDD:251636 50/223 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.