DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or7a and Or85e

DIOPT Version :9

Sequence 1:NP_511081.1 Gene:Or7a / 31750 FlyBaseID:FBgn0030016 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster


Alignment Length:189 Identity:33/189 - (17%)
Similarity:75/189 - (39%) Gaps:38/189 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 DERRQ-------EEHCAELQR--------------------CIVDHQTMLQLLDCISPVISRTIF 283
            |.:|:       :||..:|.|                    ||..|:.   :|.|...:  ..:|
  Fly   273 DSKRELNQYVLLQEHPTDLLRLSAGRKCPDQGNAFHNALVECIRLHRF---ILHCSQEL--ENLF 332

  Fly   284 VQFLITAAIMGTTMINIFIFANTN-----TKIASIIYLLAVTL-QTAPCCYQATSLMLDNERLAL 342
            ..:.:..::..|..:.:.:|...:     .:|.:.:..|.:|: :.....|....|...:.|...
  Fly   333 SPYCLVKSLQITFQLCLLVFVGVSGTREVLRIVNQLQYLGLTIFELLMFTYCGELLSRHSIRSGD 397

  Fly   343 AIFQCQWLGQSARFRKMLLYYLHRAQQPITLTAMKLFPINLATYFSIAKFSFSLYTLIK 401
            |.::..|...:...|:.:|.:|..:::.:.:||.|.:.:::....|:...:||..||::
  Fly   398 AFWRGAWWKHAHFIRQDILIFLVNSRRAVHVTAGKFYVMDVNRLRSVITQAFSFLTLLQ 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or7aNP_511081.1 7tm_6 80..394 CDD:251636 29/180 (16%)
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 29/180 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.