DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or7a and Or83a

DIOPT Version :9

Sequence 1:NP_511081.1 Gene:Or7a / 31750 FlyBaseID:FBgn0030016 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_524234.2 Gene:Or83a / 40648 FlyBaseID:FBgn0037322 Length:453 Species:Drosophila melanogaster


Alignment Length:411 Identity:71/411 - (17%)
Similarity:136/411 - (33%) Gaps:147/411 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 VRFCNYLVWFYQICYAIYSSSTFVCAFLL--GQPPY----------ALYL-------------PG 177
            ||||:.....:....:::.:..::|...:  ||...          .:||             ||
  Fly    49 VRFCDLTYELFNYFVSVHIAGLYICTIYINYGQGDLDFFVNCLIQTIIYLWTIAMKLYFRRFRPG 113

  Fly   178 L----------DWQ-RSQMQFCI----------QAWIEFLI-------MNWTCLHQASDD----- 209
            |          ::: ||.:.|..          :.||:..:       :.|..|..|..|     
  Fly   114 LLNTILSNINDEYETRSAVGFSFVTMAGSYRMSKLWIKTYVYCCYIGTIFWLALPIAYRDRSLPL 178

  Fly   210 ------------VYAVIYLYVVRIQVQLLARRVEKLGTD------DSGQVEIY------------ 244
                        ||.|::|.....|:|:.|......|..      .|||.::.            
  Fly   179 ACWYPFDYTQPGVYEVVFLLQAMGQIQVAASFASSSGLHMVLCVLISGQYDVLFCSLKNVLASSY 243

  Fly   245 ---------PDERRQEEHCAELQ-----------------------------------RCIVDHQ 265
                     .::.:.|:..|:::                                   |||..|:
  Fly   244 VLMGANMTELNQLQAEQSAADVEPGQYAYSVEEETPLQELLKVGSSMDFSSAFRLSFVRCIQHHR 308

  Fly   266 TMLQLLDCI----SPV----ISRTIFVQFLITAAIMGTTMINIFIFANTNTKIASI-IYLLAVTL 321
            .::..|..|    ||:    |....|:..|:......:|..|.|:      ::.|: .|||.|..
  Fly   309 YIVAALKKIESFYSPIWFVKIGEVTFLMCLVAFVSTKSTAANSFM------RMVSLGQYLLLVLY 367

  Fly   322 QTAPCCYQATSLMLDNERLALAIFQCQWLGQSARFRKMLLYYLHRAQQPITLTAMKLFPINLATY 386
            :....||.|..:..:::|...|:::..|.......|...::::..:::...|||.|:..:|:..:
  Fly   368 ELFIICYFADIVFQNSQRCGEALWRSPWQRHLKDVRSDYMFFMLNSRRQFQLTAGKISNLNVDRF 432

  Fly   387 FSIAKFSFSLYTLIKGMNLGE 407
            ......:||..||::.|:..|
  Fly   433 RGTITTAFSFLTLLQKMDARE 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or7aNP_511081.1 7tm_6 80..394 CDD:251636 65/396 (16%)
Or83aNP_524234.2 7tm_6 <155..440 CDD:251636 48/290 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.