DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or7a and Or67b

DIOPT Version :9

Sequence 1:NP_511081.1 Gene:Or7a / 31750 FlyBaseID:FBgn0030016 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_524007.2 Gene:Or67b / 39120 FlyBaseID:FBgn0036019 Length:421 Species:Drosophila melanogaster


Alignment Length:295 Identity:48/295 - (16%)
Similarity:104/295 - (35%) Gaps:83/295 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 FYQICYAIYSSSTFVCAFLLGQP---PYALYLPGLDWQRSQMQFCI----QAWIEFLIMNWTCLH 204
            ::|..:..|......|...|..|   || |.|...::....::|.:    ..|..|.:..:..| 
  Fly   171 YFQYIFDCYIKDKDTCEMTLTYPAIVPY-LQLGNYEFPSYVIRFFLLQSGPLWCFFAVFGFNSL- 233

  Fly   205 QASDDVYAVIYLY------VVRIQVQLLARRVEKLGTDDSGQVEIYPDER-RQEEHCAELQRCIV 262
                  :.|:..|      |:|..||           :.:..:.:..|:| :..:.|..|...|.
  Fly   234 ------FVVLTRYESGLIKVLRFLVQ-----------NSTSDILVPKDQRVKYLQCCVRLFARIS 281

  Fly   263 DHQTMLQLLDCISPVISRTIFVQFLITAAIMGTTMINIFIFANTNTKIASI------------IY 315
            .|...::           .:|...::....:.:.:|.:.::     ||:::            :|
  Fly   282 SHHNQIE-----------NLFKYIILVQCSVSSILICMLLY-----KISTVLEVGWVWMGMIMVY 330

  Fly   316 LLAVTLQTAPCCYQATSLMLDNERLALAIFQCQWLGQSARFR---KMLLYYLHRAQQPITLTAMK 377
            .:.:.|:.......|..:...:|.|....:.|.|..:|..|:   ||:|.:..|.          
  Fly   331 FVTIALEITLYNVSAQKVESQSELLFHDWYNCSWYNESREFKFMIKMMLLFSRRT---------- 385

  Fly   378 LFPINLATYFSIA--------KFSFSLYTLIKGMN 404
             |.:::..:.|::        :.|.:.:.|::.||
  Fly   386 -FVLSVGGFTSLSHKFLVQVFRLSANFFLLLRNMN 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or7aNP_511081.1 7tm_6 80..394 CDD:251636 44/283 (16%)
Or67bNP_524007.2 7tm_6 <197..408 CDD:251636 39/256 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465202
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.