DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or7a and Or10a

DIOPT Version :9

Sequence 1:NP_511081.1 Gene:Or7a / 31750 FlyBaseID:FBgn0030016 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster


Alignment Length:258 Identity:51/258 - (19%)
Similarity:106/258 - (41%) Gaps:47/258 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 FYQICYAIYSSSTFVCAFLLGQPPYALYLPGLDWQRSQMQFCIQAWIEFLIMNWTCLHQASDDVY 211
            |:.:.|...:.:.:|..|:.|.                   |...:.||      |.|.::    
  Fly   190 FFPLTYIFIAYTGYVTIFMFGG-------------------CDGFYFEF------CAHLSA---- 225

  Fly   212 AVIYLYVVRIQVQLLARRVEKLGTD--DSGQVEIYPDERRQEEHCAELQRCIVDHQTMLQLLDCI 274
               ...|::.:::.:.|..    ||  :...|::|..|::       ::..|:.|..::.|....
  Fly   226 ---LFEVLQAEIESMFRPY----TDHLELSPVQLYILEQK-------MRSVIIRHNAIIDLTRFF 276

  Fly   275 SPVISRTIFVQFLITAAIMGTTMINIFIFANTNT-KIASIIYLLAVTLQTAPCCYQATSLMLDNE 338
            ....:......|:..|.::|.:|:|:....|... .:..:.|.:|...|....||..|.:...:.
  Fly   277 RDRYTIITLAHFVSAAMVIGFSMVNLLTLGNNGLGAMLYVAYTVAALSQLLVYCYGGTLVAESST 341

  Fly   339 RLALAIFQCQWLGQSARFRKMLLYYLHRAQQPITLTAMKLFPINLATYFSIAKFSFSLYTLIK 401
            .|..|:|.|.|.....:.|:::...:.|:|:|::: |:..|..:|||:.:|.:.|.|:..|:|
  Fly   342 GLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSM-AVPFFSPSLATFAAILQTSGSIIALVK 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or7aNP_511081.1 7tm_6 80..394 CDD:251636 47/249 (19%)
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 47/249 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465130
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.