DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or7a and Or2a

DIOPT Version :9

Sequence 1:NP_511081.1 Gene:Or7a / 31750 FlyBaseID:FBgn0030016 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster


Alignment Length:392 Identity:93/392 - (23%)
Similarity:174/392 - (44%) Gaps:46/392 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GMQAPDGSRPTTSSTWQRIYACFSVVMYVWQLLLVPTFFVISY--RYMGGMEITQVLTSAQVAID 93
            |:..|    |..||.   :|..:|:.:.    |:|...|.:|.  |.:....:..:..:..:.|.
  Fly    26 GLMRP----PGVSSL---LYVVYSITVN----LVVTVLFPLSLLARLLFTTNMAGLCENLTITIT 79

  Fly    94 AVILPAKIVALAWNLPLLRRAEHHLAAL----DARCR---EQEEFQLILDAVRFCNYLVWFYQIC 151
            .::...|..    |:.::|:..|.:.:|    |||.|   :.||...:...|...       |..
  Fly    80 DIVANLKFA----NVYMVRKQLHEIRSLLRLMDARARLVGDPEEISALRKEVNIA-------QGT 133

  Fly   152 YAIYSS-----STFVCAFLLGQPPYALYLP---GLDWQRSQMQFCIQAWIEFLIMNWTCLHQASD 208
            :..::|     :|..|..::.:|...|..|   |:||..|...:.:....:...:....:...:.
  Fly   134 FRTFASIFVFGTTLSCVRVVVRPDRELLYPAWFGVDWMHSTRNYVLINIYQLFGLIVQAIQNCAS 198

  Fly   209 DVYAVIYLYVVRIQVQLLARRVEKLG--TDDSGQVEIYPDERRQEEHCAELQRCIVDHQTMLQLL 271
            |.|...:|.::...::.|..||.::|  |:.|.:.:.|  |..:||...||..||.|...:.:|.
  Fly   199 DSYPPAFLCLLTGHMRALELRVRRIGCRTEKSNKGQTY--EAWREEVYQELIECIRDLARVHRLR 261

  Fly   272 DCISPVISRTIFVQFLITAAIMGTTMINIFIFANTN---TKIASIIYLLAVTLQTAPCCYQATSL 333
            :.|..|:|.....||:.:||:..|..::....|:.:   ..|.||::..||||:....||....:
  Fly   262 EIIQRVLSVPCMAQFVCSAAVQCTVAMHFLYVADDHDHTAMIISIVFFSAVTLEVFVICYFGDRM 326

  Fly   334 MLDNERLALAIFQCQWLGQSARFRKMLLYYLHRAQQPITLTAMKLFPINLATYFSIAKFSFSLYT 398
            ...:|.|..|.:.|.|:.|..:|::.||:.|.|.|:|..:.|.....::|.|:..:.:|::|::|
  Fly   327 RTQSEALCDAFYDCNWIEQLPKFKRELLFTLARTQRPSLIYAGNYIALSLETFEQVMRFTYSVFT 391

  Fly   399 LI 400
            |:
  Fly   392 LL 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or7aNP_511081.1 7tm_6 80..394 CDD:251636 78/333 (23%)
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 78/333 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468644
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.