DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10761 and AT2G22120

DIOPT Version :9

Sequence 1:NP_572456.1 Gene:CG10761 / 31749 FlyBaseID:FBgn0030015 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001189574.1 Gene:AT2G22120 / 816746 AraportID:AT2G22120 Length:363 Species:Arabidopsis thaliana


Alignment Length:216 Identity:56/216 - (25%)
Similarity:78/216 - (36%) Gaps:66/216 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SGLEPPS------------GNVVDDRMCWICLRGDEDHRRRDWVHPCRCRGTNKWVHEACLSRWI 71
            |.|.|||            |...:...|.|||..|    .||::.||:|:||:|:||..||..|.
plant     8 SPLVPPSPMVEPSEIDLEAGGPGEQIQCRICLETD----GRDFIAPCKCKGTSKYVHRDCLDHWR 68

  Fly    72 DEKEMLSPGAPVTCTQCRTEYIIVMPPLCRFDAMLERLDKGCDR-------------------MC 117
            ..||..   |...||.|:..|.:             |:....||                   :.
plant    69 AIKEGF---AFAHCTTCKAPYYL-------------RVHSAGDRKWRTLKFRFFVTRDILSIFLA 117

  Fly   118 PSVLMGILAATVYFSAVIYGALTVLQLAGYSTGMKLLQEDPSLLMIVLPSVPTLLLLSRLVRWED 182
            ..:::..||..||| ...|....:..:.|:.:.:.......:||..      .||.||      .
plant   118 VQLVIAALAYMVYF-IDSYQQSWLRHIWGFDSEVTFYYMCGALLFF------ALLGLS------G 169

  Fly   183 CVIRWLRRRKRS--AIPAEQL 201
            |||....||.|:  |.|..:|
plant   170 CVITCYDRRVRNDLAQPCREL 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10761NP_572456.1 RINGv 33..89 CDD:128983 23/55 (42%)
AT2G22120NP_001189574.1 RING 34..83 CDD:302633 23/55 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 47 1.000 Domainoid score I4521
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.