DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10761 and Marchf5

DIOPT Version :9

Sequence 1:NP_572456.1 Gene:CG10761 / 31749 FlyBaseID:FBgn0030015 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001365726.1 Gene:Marchf5 / 69104 MGIID:1915207 Length:292 Species:Mus musculus


Alignment Length:298 Identity:104/298 - (34%)
Similarity:161/298 - (54%) Gaps:38/298 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DRMCWICLRGDEDHRRRDWVHPCRCRGTNKWVHEACLSRWIDEKEMLSPGAPVTCTQCRTEYIIV 95
            ||.||:|...|||.|..:||.||||||:.||||:|||.||:|||:..:..|.|.|.||..||:||
Mouse    11 DRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIV 75

  Fly    96 MPPLCRFDAMLERLDKGCDRMCPSVLMGILAATVYFSAVIYGALTVLQ--------------LAG 146
            .|.|.....:|:..|:...:.||....||:..::|::||.|||:||:|              :.|
Mouse    76 FPKLGPVVYVLDLADRLISKACPFAAAGIMVGSIYWTAVTYGAVTVMQVHHSLFSDTTFDVKVVG 140

  Fly   147 YSTGMKLLQE-DPSLLMIVLPSVPTLLLLSRLVRWEDCVIR-WLRRRKRSAIPAEQLDAVGLPLP 209
            :..|:.:::. ||..|:|.||::|.:|:|.:::||||.|:| |.:...:..|.......:|.|:|
Mouse   141 HKEGLDVMERADPLFLLIGLPTIPVMLILGKMIRWEDYVLRLWRKYSNKLQILNSIFPGIGCPVP 205

  Fly   210 GAPLSDEYFDELEREYPASDGLIGGNLATEQLGRASTSFCIALSLPTISVVLGQKLFGRIYEENK 274
            ..|....         |.:|.:           .|:...|.||..|||:.::|:.:|..:  .:.
Mouse   206 RIPAEAN---------PLADHV-----------SATRILCGALVFPTIATIVGKLMFSSV--NSN 248

  Fly   275 LLSILLGGLTFVTIKGLASIFLSQSQYQQRRHRFVMDY 312
            |...:|||:.||.|||...::..|.||.::.||.:::|
Mouse   249 LQRTILGGIAFVAIKGAFKVYFKQQQYLRQAHRKILNY 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10761NP_572456.1 RINGv 33..89 CDD:128983 31/55 (56%)
Marchf5NP_001365726.1 RING_CH-C4HC3_MARCH5 12..72 CDD:319615 33/59 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843219
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6573
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1210654at2759
OrthoFinder 1 1.000 - - FOG0003968
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46283
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X270
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.760

Return to query results.
Submit another query.