DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10761 and MARCHF7

DIOPT Version :9

Sequence 1:	NP_572456.1	Gene:	CG10761 / 31749	FlyBaseID:	FBgn0030015	Length:	323	Species:	Drosophila melanogaster
Sequence 2:	NP_001269734.1	Gene:	MARCHF7 / 64844	HGNCID:	17393	Length:	704	Species:	Homo sapiens

Alignment Length:	141	Identity:	27/141 - (19%)
Similarity:	53/141 - (37%)	Gaps:	40/141 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly    13 RLRRLRSGLEPPSGNVVDDRMCWICLRGDEDHRRRDWVHPCRCRGTNKWVHEACLSRWIDEKEML 77
            ||::::..|........:..:|.||.......... .:.||:|.|:.::||:.|:.:|:..|  :
Human   531 RLQKIKESLLLEDSEEEEGDLCRICQMAAASSSNL-LIEPCKCTGSLQYVHQDCMKKWLQAK--I 592

  Fly    78 SPG----APVTCTQCRTE-------------------------------YIIVMPPLCR--FDAM 105
            :.|    |..||..|:.:                               |::|:..||.  |..|
Human   593 NSGSSLEAVTTCELCKEKLELNLEDFDIHELHRAHANEQAEYEFISSGLYLVVLLHLCEQSFSDM 657

  Fly   106 LERLDKGCDRM 116
            :...::...|:
Human   658 MGNTNEPSTRV 668

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10761	NP_572456.1	RINGv	33..89	CDD:128983	16/59 (27%)
MARCHF7	NP_001269734.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..126
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	157..279
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	294..313
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	319..343
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	361..425
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	444..473
		RING_Ubox	552..610	CDD:388418	17/60 (28%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	683..704
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R328
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.940