DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10761 and marc-1

DIOPT Version :9

Sequence 1:NP_572456.1 Gene:CG10761 / 31749 FlyBaseID:FBgn0030015 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001122964.1 Gene:marc-1 / 6418739 WormBaseID:WBGene00077696 Length:206 Species:Caenorhabditis elegans


Alignment Length:156 Identity:33/156 - (21%)
Similarity:54/156 - (34%) Gaps:66/156 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RMCWICLRGDEDHRRRDWVHPCRCRGTNKWVHEACLSRWIDEKEMLSPGAPVTCTQCRTEY---- 92
            |:|.||     .....|.|.||.|.||...|||.||::|::...      ..||..|::||    
 Worm    50 RICRIC-----QMHEGDMVRPCDCAGTMGDVHEECLTKWVNMSN------KKTCEICKSEYTNSG 103

  Fly    93 -----------------------------------IIVMPPLCRFDAMLERL------DKGCDRM 116
                                               :|||...|.:..::|:.      |.|  |:
 Worm   104 AQFKPIKQWSKPKCSLNNIFHVLIIVLLGLLISYVVIVMEERCFYKRIIEKNMYARPDDTG--RI 166

  Fly   117 CPSVLMGILAATVYFSAVIYGALTVL 142
            |..:::.:        |::....|::
 Worm   167 CVIIILSL--------AILNNVYTLI 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10761NP_572456.1 RINGv 33..89 CDD:128983 18/55 (33%)
marc-1NP_001122964.1 RINGv 51..96 CDD:128983 18/55 (33%)
RING-CH finger (C4HC3-type) 52..95 CDD:319361 18/53 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R328
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.