DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10761 and Marchf10

DIOPT Version :9

Sequence 1:NP_572456.1 Gene:CG10761 / 31749 FlyBaseID:FBgn0030015 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_766156.2 Gene:Marchf10 / 632687 MGIID:2443469 Length:788 Species:Mus musculus


Alignment Length:87 Identity:23/87 - (26%)
Similarity:42/87 - (48%) Gaps:9/87 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RLRRLRSGLEPPSGNVVDDRMCWIC-LRGDEDHRRRDWVHPCRCRGTNKWVHEACLSRWIDEKEM 76
            :||:|:..|........:..:|.|| :.|...  ....:.||.|.|:.::||:.||.:|:  |..
Mouse   618 KLRKLQESLLEEDSEEEEGDLCRICQIAGGSP--ANPLLEPCGCVGSLQFVHQECLKKWL--KVK 678

  Fly    77 LSPGAPV----TCTQCRTEYII 94
            ::.||.:    ||..|:...::
Mouse   679 ITSGADLGTVKTCEMCKQGLLV 700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10761NP_572456.1 RINGv 33..89 CDD:128983 18/60 (30%)
Marchf10NP_766156.2 RING_CH-C4HC3_MARCH10 639..698 CDD:319727 19/62 (31%)
RING-CH finger (C4HC3-type) 639..694 CDD:319727 18/58 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R328
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.