DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10761 and march5

DIOPT Version :9

Sequence 1:NP_572456.1 Gene:CG10761 / 31749 FlyBaseID:FBgn0030015 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001076296.1 Gene:march5 / 561952 ZFINID:ZDB-GENE-070424-47 Length:281 Species:Danio rerio


Alignment Length:284 Identity:102/284 - (35%)
Similarity:161/284 - (56%) Gaps:24/284 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DRMCWICLRGDEDHRRRDWVHPCRCRGTNKWVHEACLSRWIDEKEMLSPGAPVTCTQCRTEYIIV 95
            ||.||:|...|||.|..:||.||||||:.||||::||.||:|||:..:..|.|.|.||..||:||
Zfish    14 DRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQSCLQRWVDEKQRGNSTARVACPQCNAEYLIV 78

  Fly    96 MPPLCRFDAMLERLDKGCDRMCPSVLMGILAATVYFSAVIYGALTVLQLAGYSTGMKLLQE-DPS 159
            .|.|.....:|:..|:...:.||....||:..::|::||.|||:||:|:.|:..|:.:::. ||.
Zfish    79 FPKLGPVVYVLDLADRLISKACPFAAAGIMVGSIYWTAVTYGAVTVMQVVGHKEGLDVMERADPL 143

  Fly   160 LLMIVLPSVPTLLLLSRLVRWEDCVIR-WLRRRKRSAIPAEQLDAVGLPLPGAPLSDEYFDELER 223
            .|:|.||::|.:|:|.:::||||.|:| |.:...:..|.......:|.|:|..|....       
Zfish   144 FLLIGLPTIPVMLILGKMIRWEDYVLRLWRKYSNKLQILNSIFPGIGCPVPRIPAEAS------- 201

  Fly   224 EYPASDGLIGGNLATEQLGRASTSFCIALSLPTISVVLGQKLFGRIYEENKLLSILLGGLTFVTI 288
              |.:|.:           .|:...|.||..|||:.::|:.:|..:  .:.|...:|||:.||.|
Zfish   202 --PLADHV-----------SATRILCGALVFPTIATIVGKLMFSSV--NSNLQRTILGGIAFVAI 251

  Fly   289 KGLASIFLSQSQYQQRRHRFVMDY 312
            ||...::..|.||.::.||.::::
Zfish   252 KGAFKVYFKQQQYLRQAHRKILNF 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10761NP_572456.1 RINGv 33..89 CDD:128983 30/55 (55%)
march5NP_001076296.1 RINGv 17..72 CDD:128983 30/54 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588162
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1210654at2759
OrthoFinder 1 1.000 - - FOG0003968
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46283
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X270
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.