DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10761 and CG13442

DIOPT Version :9

Sequence 1:NP_572456.1 Gene:CG10761 / 31749 FlyBaseID:FBgn0030015 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_611511.3 Gene:CG13442 / 37349 FlyBaseID:FBgn0034546 Length:425 Species:Drosophila melanogaster


Alignment Length:253 Identity:59/253 - (23%)
Similarity:83/253 - (32%) Gaps:81/253 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PPSGNVVDDRMCWICLRGDEDHRRRDWVHPCRCRGTNKWVHEACLSRWIDEKEMLSPGAPVTCTQ 87
            |..|::|    |.||...|...:   .|.||.|:|:..:||..||..||....         ||.
  Fly   160 PSVGSLV----CRICHNADNPEQ---LVSPCLCKGSLTYVHVHCLECWISTSR---------CTT 208

  Fly    88 CRTEYIIVMPPLCRFD---------------------AMLER-LDKGCDRMCPSVLMGILAATVY 130
            |.         ||:|.                     ||..| |.:.|.       |..|...|.
  Fly   209 CE---------LCQFQYNTEQTLRYTCLQSLRLWYSRAMSRRALQEDCQ-------MFSLLTLVA 257

  Fly   131 FSAVIYGALTV----LQLAGYSTGMKLLQEDPSLLMIVLPSVPT------LLLLSRLVRWEDCVI 185
            |.  |.|.|.|    ..|..:|.|:..|.....:|..:..::..      :|:.|:|..|    .
  Fly   258 FG--IIGTLLVGIQYYALHTHSWGLSKLWTKSWMLFFLFMTITVYFANIYMLIKSQLTPW----Y 316

  Fly   186 RW----------LRRRKRSAIPAEQLDAVGLPLPGAPLS-DEYFDELEREYPASDGLI 232
            ||          |..|:....|:..|.:..|.......| ..:.|:.|...|:|..:|
  Fly   317 RWWQSARDIKLILENRRPFPNPSRFLRSFQLETVSTTASMYTHHDQQEAPVPSSSPVI 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10761NP_572456.1 RINGv 33..89 CDD:128983 17/55 (31%)
CG13442NP_611511.3 AmyAc_family <36..>151 CDD:298606
RINGv 166..213 CDD:128983 20/71 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1210654at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X270
22.010

Return to query results.
Submit another query.