DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10761 and CG2991

DIOPT Version :9

Sequence 1:NP_572456.1 Gene:CG10761 / 31749 FlyBaseID:FBgn0030015 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_608725.1 Gene:CG2991 / 33488 FlyBaseID:FBgn0031474 Length:562 Species:Drosophila melanogaster


Alignment Length:95 Identity:30/95 - (31%)
Similarity:41/95 - (43%) Gaps:7/95 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRQFMHLPLHSRLRRLRSGLEPPSG-NVVDDRMCWICLRGDEDHRRRDWVHPCRCRGTNKWVHE 64
            :|||..  |....|....:.|.|..| :.:..:.||||...|   :....:.||||.|....||.
  Fly   360 LSRQID--PSIPTLNAETNKLSPEEGQSFLTKKDCWICYDSD---KPEPLIQPCRCTGDVSSVHH 419

  Fly    65 ACLSRWIDEKEMLSPGAPVTCTQCRTEYII 94
            .||.||:.| ...:..|.::|..|...|.|
  Fly   420 ECLKRWLVE-SCSNSEAQLSCKVCGHPYEI 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10761NP_572456.1 RINGv 33..89 CDD:128983 19/55 (35%)
CG2991NP_608725.1 SSM4 389..>494 CDD:227510 22/64 (34%)
RING_CH-C4HC3_MARCH 392..443 CDD:319409 19/54 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1210654at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.