DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10761 and march5l

DIOPT Version :9

Sequence 1:NP_572456.1 Gene:CG10761 / 31749 FlyBaseID:FBgn0030015 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_956033.2 Gene:march5l / 326067 ZFINID:ZDB-GENE-030131-4792 Length:289 Species:Danio rerio


Alignment Length:293 Identity:101/293 - (34%)
Similarity:168/293 - (57%) Gaps:30/293 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EPPSGNVVDDRMCWICLRGDEDHRRRDWVHPCRCRGTNKWVHEACLSRWIDEKEMLSPGAPVTCT 86
            |||      ::.||:|...:::.|..:||.||||:|..||:|::||.||:|||:..:.|..|:|.
Zfish     6 EPP------EKHCWVCFATEKEDRAAEWVSPCRCKGCTKWIHQSCLQRWLDEKQKGNSGGAVSCP 64

  Fly    87 QCRTEYIIVMPPLCRFDAMLERLDKGCDRMCPSVLMGILAATVYFSAVIYGALTVLQLAGYSTGM 151
            ||.|||.||.|.:......|:::|:...|..|....|::..|||:|||.|||:||:|:.|:..|:
Zfish    65 QCGTEYRIVFPKMGPVVYFLQQVDRALSRASPFAAAGVVVGTVYWSAVTYGAVTVMQVVGHKKGL 129

  Fly   152 KLLQE-DPSLLMIVLPSVPTLLLLSRLVRWEDCVIR-WLRRRKRSAIPAEQLDAVGLPLPGAPLS 214
            .:::. ||..|::.||::|.:|:|.:::||||.|:| |.|...:..|.:..:..:|..||..|:.
Zfish   130 DVMERADPLFLLMGLPTIPVMLVLGKMIRWEDYVVRLWQRHSAKLQIFSGLVPGMGRALPRVPVE 194

  Fly   215 DEYFDELEREYPASDGLIGGNLATEQLGRASTSFCIALSLPTISVVLGQKLFGRIYEENKLLSIL 279
            ..|               ||:..:     .|.:.|.||..|:|:.::|:.||.|:  .:.|...:
Zfish   195 GSY---------------GGDHLS-----VSRTLCGALIFPSIANLVGRLLFRRV--TSNLQRTI 237

  Fly   280 LGGLTFVTIKGLASIFLSQSQYQQRRHRFVMDY 312
            |||:.||.:||:..::..|.||..:.:|.:::|
Zfish   238 LGGIAFVVMKGVLKVYFKQQQYLIQANRHILNY 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10761NP_572456.1 RINGv 33..89 CDD:128983 25/55 (45%)
march5lNP_956033.2 RINGv 11..67 CDD:128983 25/55 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170588158
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1210654at2759
OrthoFinder 1 1.000 - - FOG0003968
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46283
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X270
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.