DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10761 and Marchf5

DIOPT Version :9

Sequence 1:NP_572456.1 Gene:CG10761 / 31749 FlyBaseID:FBgn0030015 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_008758589.1 Gene:Marchf5 / 294079 RGDID:1305617 Length:293 Species:Rattus norvegicus


Alignment Length:299 Identity:104/299 - (34%)
Similarity:161/299 - (53%) Gaps:39/299 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DRMCWICLRGDEDHRRRDWVHPCRCRGTNKWVHEACLSRWIDEKEMLSPGAPVTCTQCRTEYIIV 95
            ||.||:|...|||.|..:||.||||||:.||||:|||.||:|||:..:..|.|.|.||..||:||
  Rat    11 DRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIV 75

  Fly    96 MPPLCRFDAMLERLDKGCDRMCPSVLMGILAATVYFSAVIYGALTVLQ---------------LA 145
            .|.|.....:|:..|:...:.||....||:..::|::||.|||:||:|               :.
  Rat    76 FPKLGPVVYVLDLADRLISKACPFAAAGIMVGSIYWTAVTYGAVTVMQVHHSTLFSDTTFDVKVV 140

  Fly   146 GYSTGMKLLQE-DPSLLMIVLPSVPTLLLLSRLVRWEDCVIR-WLRRRKRSAIPAEQLDAVGLPL 208
            |:..|:.:::. ||..|:|.||::|.:|:|.:::||||.|:| |.:...:..|.......:|.|:
  Rat   141 GHKEGLDVMERADPLFLLIGLPTIPVMLILGKMIRWEDYVLRLWRKYSNKLQILNSIFPGIGCPV 205

  Fly   209 PGAPLSDEYFDELEREYPASDGLIGGNLATEQLGRASTSFCIALSLPTISVVLGQKLFGRIYEEN 273
            |..|....         |.:|.:           .|:...|.||..|||:.::|:.:|..:  .:
  Rat   206 PRIPAEAN---------PLADHV-----------SATRILCGALVFPTIATIVGKLMFSSV--NS 248

  Fly   274 KLLSILLGGLTFVTIKGLASIFLSQSQYQQRRHRFVMDY 312
            .|...:|||:.||.|||...::..|.||.::.||.:::|
  Rat   249 NLQRTILGGIAFVAIKGAFKVYFKQQQYLRQAHRKILNY 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10761NP_572456.1 RINGv 33..89 CDD:128983 31/55 (56%)
Marchf5XP_008758589.1 RING_CH-C4HC3_MARCH5 12..72 CDD:319615 33/59 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346725
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1210654at2759
OrthoFinder 1 1.000 - - FOG0003968
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46283
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X270
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.