DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10761 and doa10

DIOPT Version :9

Sequence 1:NP_572456.1 Gene:CG10761 / 31749 FlyBaseID:FBgn0030015 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_596733.1 Gene:doa10 / 2539855 PomBaseID:SPBC14F5.07 Length:1242 Species:Schizosaccharomyces pombe


Alignment Length:190 Identity:43/190 - (22%)
Similarity:68/190 - (35%) Gaps:48/190 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DDRMCWIC-LRGDEDHRRRDWVHPCRCRGTNKWVHEACLSRWIDEKEMLSPGAPVTCTQCRTE-- 91
            ||.:|.:| ..|..|   ....|||:|.|:.::||:.||..|:...:      ...|..|:.:  
pombe     4 DDEICRVCRCEGAPD---SPLFHPCKCTGSIRYVHQECLVEWLGHSK------KTHCELCKAKFE 59

  Fly    92 ----YIIVMPPLCRFDAMLERLDKGCDR------------MCPSVLMGILAATVYFSAVIYG--- 137
                |...||....|..:..:|.....:            .|.:||:.::...|:......|   
pombe    60 FTKVYSESMPRTIPFTILCRKLASTLKQRVIFFTRVLLTFFCWTVLLPLIFKHVWNLNFKIGDTY 124

  Fly   138 -------ALTVLQLAGYSTGMKLLQEDPSLLMI--------VLPSVPTLLLLSR-LVR-W 180
                   ..|..|..||...:..:...|.|..:        ||..|.|.:|::. ||| |
pombe   125 TIHARNKTFTAPQKPGYFESISQITSSPRLNTLIANTAEGQVLTFVVTFILITAFLVREW 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10761NP_572456.1 RINGv 33..89 CDD:128983 15/56 (27%)
doa10NP_596733.1 SSM4 1..1239 CDD:227510 43/190 (23%)
RINGv 7..55 CDD:128983 15/56 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R328
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.