DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10761 and MARCHF8

DIOPT Version :9

Sequence 1:	NP_572456.1	Gene:	CG10761 / 31749	FlyBaseID:	FBgn0030015	Length:	323	Species:	Drosophila melanogaster
Sequence 2:	NP_001269795.1	Gene:	MARCHF8 / 220972	HGNCID:	23356	Length:	573	Species:	Homo sapiens

Alignment Length:	140	Identity:	39/140 - (27%)
Similarity:	65/140 - (46%)	Gaps:	26/140 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly    23 PP------SGNVVDDRMCWIC-LRGDEDHRRRDWVHPCRCRGTNKWVHEACLSRWIDEKEMLSPG 80
            ||      ||:|     |.|| ..||::   ...:.||.|.|:..:||:|||.:||...:..
Human   350 PPISPVSTSGDV-----CRICHCEGDDE---SPLITPCHCTGSLHFVHQACLQQWIKSSDTR--- 403

  Fly    81 APVTCTQCRTEYII--VMPPLCRFDAMLERLDKGCDRMCPSVLMGILAAT-VYFSAVIYGALTVL 142
               .|..|:.|:|:  .:.||.:::.:.....:....|| ||...::|.| |.:|..:....|..
Human   404 ---CCELCKYEFIMETKLKPLRKWEKLQMTSSERRKIMC-SVTFHVIAITCVVWSLYVLIDRTAE 464

  Fly   143 QL-AGYSTGM 151
            :: .|.:||:
Human   465 EIKQGQATGI 474

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10761	NP_572456.1	RINGv	33..89	CDD:128983	17/56 (30%)
MARCHF8	NP_001269795.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	22..72
MARCHF8	NP_001269795.1	RINGv	361..409	CDD:128983	18/61 (30%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R328
SonicParanoid	1	1.000	-	-		X270
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	3	2.940