DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10761 and M110.3

DIOPT Version :9

Sequence 1:NP_572456.1 Gene:CG10761 / 31749 FlyBaseID:FBgn0030015 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_495728.1 Gene:M110.3 / 187472 WormBaseID:WBGene00010913 Length:189 Species:Caenorhabditis elegans


Alignment Length:62 Identity:24/62 - (38%)
Similarity:32/62 - (51%) Gaps:4/62 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DRMCWICLRGDEDHRRRDWVHPCRCRGTNKWVHEACLSRWIDEKEMLSPGAPVTCTQCRTEY 92
            ::.|..|. |.|......:||||||||:..|||..||:.|..:...:.   .|.|.||:|.|
 Worm    13 EKYCKFCF-GTESDNALSFVHPCRCRGSIHWVHHQCLAMWFSKANAVQ---QVMCIQCQTRY 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10761NP_572456.1 RINGv 33..89 CDD:128983 21/55 (38%)
M110.3NP_495728.1 RING_CH-C4HC3_MARCH 16..67 CDD:319409 21/54 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162766
Domainoid 1 1.000 59 1.000 Domainoid score I7056
eggNOG 1 0.900 - - E1_KOG3053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D426217at33208
OrthoFinder 1 1.000 - - FOG0003968
OrthoInspector 1 1.000 - - otm14746
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X270
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.710

Return to query results.
Submit another query.