DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10761 and marchf5

DIOPT Version :9

Sequence 1:NP_572456.1 Gene:CG10761 / 31749 FlyBaseID:FBgn0030015 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001116950.1 Gene:marchf5 / 100144728 XenbaseID:XB-GENE-946356 Length:283 Species:Xenopus tropicalis


Alignment Length:283 Identity:104/283 - (36%)
Similarity:160/283 - (56%) Gaps:24/283 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DRMCWICLRGDEDHRRRDWVHPCRCRGTNKWVHEACLSRWIDEKEMLSPGAPVTCTQCRTEYIIV 95
            ||.||:|...|||.|..:||.||||||:.||||:|||.||:|||:..:..|.|.|.||..||:||
 Frog    14 DRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIV 78

  Fly    96 MPPLCRFDAMLERLDKGCDRMCPSVLMGILAATVYFSAVIYGALTVLQLAGYSTGMKLLQE-DPS 159
            .|.|.....:|:..|:...:.||....||:..::|::||.|||:||:|:.|:..|:.:::. ||.
 Frog    79 FPNLGPVVYVLDLADRLISKACPFAAAGIMVGSIYWTAVTYGAVTVMQVVGHKEGLDVMERADPL 143

  Fly   160 LLMIVLPSVPTLLLLSRLVRWEDCVIR-WLRRRKRSAIPAEQLDAVGLPLPGAPLSDEYFDELER 223
            .|:|.||::|.:|:|.:::||||.|:| |.:...:..|.......:|.|:|..|....       
 Frog   144 FLLIGLPTIPVVLILGKMIRWEDYVLRLWRKYSNKLQILNSIFPGIGCPVPRVPAEAN------- 201

  Fly   224 EYPASDGLIGGNLATEQLGRASTSFCIALSLPTISVVLGQKLFGRIYEENKLLSILLGGLTFVTI 288
              |.:|.:           .|:...|.||..|||:.::|:.:|..:  .:.|...:|||:.||.|
 Frog   202 --PLADHV-----------SATRILCGALVFPTIATIVGKLMFSTV--NSNLQRTILGGIAFVAI 251

  Fly   289 KGLASIFLSQSQYQQRRHRFVMD 311
            ||...::..|.||.::.||.::|
 Frog   252 KGAFKVYFKQQQYLRQAHRKILD 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10761NP_572456.1 RINGv 33..89 CDD:128983 31/55 (56%)
marchf5NP_001116950.1 RING_CH-C4HC3_MARCH5 15..75 CDD:319615 33/59 (56%)
RING-CH finger (C4HC3-type) 17..71 CDD:319615 30/53 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1210654at2759
OrthoFinder 1 1.000 - - FOG0003968
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46283
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X270
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.