DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GIIIspla2 and PLA2-BETA

DIOPT Version :9

Sequence 1:NP_001285008.1 Gene:GIIIspla2 / 31747 FlyBaseID:FBgn0030013 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001189554.1 Gene:PLA2-BETA / 816488 AraportID:AT2G19690 Length:148 Species:Arabidopsis thaliana


Alignment Length:140 Identity:33/140 - (23%)
Similarity:54/140 - (38%) Gaps:38/140 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 IAPNTRWCGRGNLANGTYNDLGGA--------SKADKCCRKHDHCKMWIDGMSNRYDLFNYRPYT 141
            ||.|   |...::..|.|..:|.:        ...|.||:.|||| :.::||:|           
plant    36 IAQN---CDTLSIRYGKYCGIGHSGCPGEEPCDDLDACCKIHDHC-VELNGMTN----------- 85

  Fly   142 LSHCSCDLRFRTC---LKMAGDEDANAIGKLFFNVVQTQCFGLKAETVCVQRGGSGKETDPCLKE 203
               .||..:|:.|   |..|..:..|.  |:.|:   |:|    ..:|.:.....|.:......:
plant    86 ---ISCHKKFQRCVNRLSKAIKQSKNK--KVGFS---TKC----PYSVVIPTVNQGMDIGILFSQ 138

  Fly   204 EVRHKAFLRD 213
            ...|:.|:.|
plant   139 LAYHRKFVTD 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GIIIspla2NP_001285008.1 PLA2_bee_venom_like 84..181 CDD:153093 28/106 (26%)
PLA2-BETANP_001189554.1 PLA2_plant 25..139 CDD:153095 30/129 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.