DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GIIIspla2 and OC90

DIOPT Version :9

Sequence 1:NP_001285008.1 Gene:GIIIspla2 / 31747 FlyBaseID:FBgn0030013 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001073868.2 Gene:OC90 / 729330 HGNCID:8100 Length:477 Species:Homo sapiens


Alignment Length:176 Identity:37/176 - (21%)
Similarity:56/176 - (31%) Gaps:61/176 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 QLSDWLIAPNTR----------WC---GRGNLANGTYNDLGGASKADKCCRKHDHCKMWIDGMSN 130
            ||.:.|....:|          :|   |||.    ..:||      |:||..|..|...:..:..
Human   307 QLGEMLFCLTSRCPEEFESYGCYCGQEGRGE----PRDDL------DRCCLSHHCCLEQVRRLGC 361

  Fly   131 RYDLFNYRPYT-LSH--------------CSCDLRFRTCLKMAG-DEDANAIGKLFFNVVQTQCF 179
            ..:...:.|.. :.|              |:||.....|:..|. ::...:..:|       .|.
Human   362 LLERLPWSPVVCVDHTPKCGGQSLCEKLLCACDQTAAECMTSASFNQSLKSPSRL-------GCP 419

  Fly   180 GLKAETVCVQR----------GGSGK---ETDPCLKEEVRHKAFLR 212
            |..|  .|...          |.|.:   |.||..::..|.|.|||
Human   420 GQPA--ACEDSLHPVPAAPTLGSSSEEDSEEDPPQEDLGRAKRFLR 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GIIIspla2NP_001285008.1 PLA2_bee_venom_like 84..181 CDD:153093 22/125 (18%)
OC90NP_001073868.2 Phospholipase A2-like 1 76..190
otoconin_90 78..195 CDD:153096
Phospholipase A2-like 2 305..361 15/63 (24%)
otoconin_90 307..423 CDD:153096 25/132 (19%)
Phospholipase A2-like 3 373..425 10/60 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..477 10/36 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.